• Gene id: 9991

Gene Summary

• Gene Symbol: PTBP3   Gene   UCSC   Ensembl
• Aliases: ROD1
• Gene name: polypyrimidine tract binding protein 3
• Alternate names: polypyrimidine tract-binding protein 3, ROD1 regulator of differentiation 1, fission yeast differentiation regulator, regulator of differentiation 1,
• Gene location: 9q32 (112333668: 112217714)     Exons: 16     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene binds RNA and is a regulator of cell differentiation. The encoded protein preferentially binds to poly(G) and poly(U) sequences in vitro. Several transcript variants encoding different isoforms have been found for this gen
• OMIM: 615089

Protein Summary

• Protein general information: O95758  
  • Name: Polypyrimidine tract binding protein 3 (Regulator of differentiation 1) (Rod1)
  • Length: 552  
  • Mass: 59690
  • Tissue specificity: Expressed in several hematopoietic cell lines examined. {ECO
• Sequence:

  MDGVVTDLITVGLKRGSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEI
  ISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQARAQAA
  LQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQ
  YADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAAFGAPGI
  ISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGNSVLLVTNLNPDLITPHGL
  FILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKD
  FSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEA
  IQALIELHNHDLGENHHLRVSFSKSTI

• Structural information:
  • Protein Domains: (59..14-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (182..25-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (358..43-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (-)
  • Interpro: IPR006536  IPR012677  IPR034798  IPR021790  IPR033110   IPR035979  IPR034326  IPR000504  
  • Prosite: PS50102
  • CDD: cd12779 cd12693 cd12703
  • STRING: ENSP00000414921
• Other Databases: GeneCards:  PTBP3  Malacards:  PTBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0006417	regulation of translation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0043484	regulation of RNA splicing	IBA	biological process
GO:0048025	negative regulation of mRNA splicing, via spliceosome	IBA	biological process
GO:0033119	negative regulation of RNA splicing	IDA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0045595	regulation of cell differentiation	IEA	biological process
GO:0043249	erythrocyte maturation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881