• Gene id: 999

Gene Summary

• Gene Symbol: CDH1   Gene   UCSC   Ensembl
• Aliases: Arc-1, BCDS1, CD324, CDHE, ECAD, LCAM, UVO
• Gene name: cadherin 1
• Alternate names: cadherin-1, CAM 120/80, E-cadherin 1, cadherin 1, E-cadherin (epithelial), cadherin 1, type 1, E-cadherin (epithelial), calcium-dependent adhesion protein, epithelial, cell-CAM 120/80, epithelial cadherin, uvomorulin,
• Gene location: 16q22.1 (68737289: 68835541)     Exons: 16     NC_000016.10
• Gene summary(Entrez): This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This cal
• OMIM: 192090

Protein Summary

• Protein general information: P12830  
  • Name: Cadherin 1 (CAM 120/80) (Epithelial cadherin) (E cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E Cad/CTF1; E Cad/CTF2; E Cad/CTF3]
  • Length: 882  
  • Mass: 97,456
• Sequence:

  MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRF
  KVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLR
  RQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERI
  ATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
  AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIF
  NPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQY
  ILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRI
  WRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
  FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNK
  DQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRD
  NVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAP
  PYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD

• Structural information:
  • Protein Domains: Cadherin (155-262)
    Cadherin (263-375)
    Cadherin (376-486)
    Cadherin (487-593)
  • Interpro: IPR002126  IPR015919  IPR020894  IPR000233  IPR014868   IPR027397  
  • Prosite: PS00232 PS50268
  • PDB: 1O6S 2O72 2OMT 2OMU 2OMV 2OMX 2OMY 2OMZ 3FF7 3FF8 3L6X 3L6Y 4ZT1 4ZTE
  • PDBsum: 1O6S 2O72 2OMT 2OMU 2OMV 2OMX 2OMY 2OMZ 3FF7 3FF8 3L6X 3L6Y 4ZT1 4ZTE
  • DIP: 477
  • STRING: ENSP00000261769
• Other Databases: GeneCards:  CDH1  Malacards:  CDH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005802	trans-Golgi network	IMP	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	NAS	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	NAS	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0016337	single organismal cell-cell adhesion	IDA	biological process
GO:0016337	single organismal cell-cell adhesion	IDA	biological process
GO:0016342	catenin complex	IDA	cellular component
GO:0016600	flotillin complex	IDA	cellular component
GO:0021983	pituitary gland development	IEA	biological process
GO:0022408	negative regulation of cell-cell adhesion	IMP	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030506	ankyrin binding	IPI	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0032794	GTPase activating protein binding	IPI	molecular function
GO:0034332	adherens junction organization	IMP	biological process
GO:0034332	adherens junction organization	TAS	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042993	positive regulation of transcription factor import into nucleus	IDA	biological process
GO:0043296	apical junction complex	IDA	cellular component
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050839	cell adhesion molecule binding	NAS	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071285	cellular response to lithium ion	IDA	biological process
GO:0071681	cellular response to indole-3-methanol	IDA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0030864	cortical actin cytoskeleton	IDA	cellular component
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005802	trans-Golgi network	IMP	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	NAS	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	NAS	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0010033	response to organic substance	IEA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0016337	single organismal cell-cell adhesion	IDA	biological process
GO:0016337	single organismal cell-cell adhesion	IDA	biological process
GO:0016342	catenin complex	IDA	cellular component
GO:0016600	flotillin complex	IDA	cellular component
GO:0021983	pituitary gland development	IEA	biological process
GO:0022408	negative regulation of cell-cell adhesion	IMP	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030506	ankyrin binding	IPI	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0032794	GTPase activating protein binding	IPI	molecular function
GO:0034332	adherens junction organization	IMP	biological process
GO:0034332	adherens junction organization	TAS	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042993	positive regulation of transcription factor import into nucleus	IDA	biological process
GO:0043296	apical junction complex	IDA	cellular component
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050839	cell adhesion molecule binding	NAS	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071285	cellular response to lithium ion	IDA	biological process
GO:0071681	cellular response to indole-3-methanol	IDA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0030864	cortical actin cytoskeleton	IDA	cellular component
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005802	trans-Golgi network	IMP	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005913	cell-cell adherens junction	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	NAS	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	NAS	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0016337	single organismal cell-cell adhesion	IDA	biological process
GO:0016337	single organismal cell-cell adhesion	IDA	biological process
GO:0016342	catenin complex	IDA	cellular component
GO:0016600	flotillin complex	IDA	cellular component
GO:0022408	negative regulation of cell-cell adhesion	IMP	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030506	ankyrin binding	IPI	molecular function
GO:0032794	GTPase activating protein binding	IPI	molecular function
GO:0034332	adherens junction organization	IMP	biological process
GO:0034332	adherens junction organization	TAS	biological process
GO:0042993	positive regulation of transcription factor import into nucleus	IDA	biological process
GO:0043296	apical junction complex	IDA	cellular component
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050839	cell adhesion molecule binding	NAS	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071285	cellular response to lithium ion	IDA	biological process
GO:0071681	cellular response to indole-3-methanol	IDA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0030864	cortical actin cytoskeleton	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04520	Adherens junction
hsa05200	Pathways in cancer
hsa05226	Gastric cancer
hsa05216	Thyroid cancer
hsa05218	Melanoma
hsa05219	Bladder cancer
hsa05213	Endometrial cancer
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Cancer (cervical)	GAD: 19563064
Cancer (colorectal)	GAD: 11158177
Cancer (esophageal)	GAD: 15890089
Cancer (gastric)	GAD: 11920500, H00018
Cancer (gastrointestinal)	GAD: 12444556
Cancer (glaucoma)	GAD: 16276119
Cancer (Hepatocellular)	GAD: 17548247, H00048
Cancer (leiomyoma)	GAD: 20651370
Cancer (lung)	GAD: 18676680
Cancer (meningioma)	GAD: 15824172
Cancer (nasopharyngeal)	GAD: 20462505
Cancer (penile)	KEGG: H00025
Cancer (thyroid)	KEGG: H00032
Cancer	GAD: 19661089
Cancer (Adenocarcinoma)	GAD: 18197935
Cancer (bladder)	GAD: 14501773
Cancer (ovarian)	GAD: 18393242
Cancer (pancreatic)	GAD: 20113833
Cancer (prostate)	GAD: 16189707
Cancer (Renal cell)	GAD: 19551141
Cancer (stomach)	GAD: 16215948
Cancer (transitional cell)	GAD: 14501773
Cancer (urothelial)	GAD: 12767511
Cancer (breast)	GAD: 12036913
Cleft defects	GAD: 18683894
Ulcerative colitis	GAD: 19915572
Crohn's disease	GAD: 19398441
Female infertility	INFBASE: 20410224
Primary infertility	INFBASE: 25150394
Endometriotic lesions	INFBASE: 11966474
Female infertility	INFBASE: 24700054
Hydrosalpinx	INFBASE: 20605145
Polycystic ovary syndrome (PCOS)	INFBASE: 23338533
Ovarian endometrial cysts	INFBASE: 9647570
Ovarian endometriosis	INFBASE: 8841809
Endometriosis	INFBASE: 23639674
Female infertility	INFBASE: 23899551
Oligozoospermia	MIK: 15033487
Adenomyosis	INFBASE: 19137776
Endometriosis	INFBASE: 9392916
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Oligozoospermia	MIK: 15033487
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15033487	Oligozoospermia				Male infertility
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881