• Gene id: 9988

Gene Summary

• Gene Symbol: DMTF1   Gene   UCSC   Ensembl
• Aliases: DMP1, DMTF, MRUL, hDMP1
• Gene name: cyclin D binding myb like transcription factor 1
• Alternate names: cyclin-D-binding Myb-like transcription factor 1, cyclin D-binding Myb-like protein, cyclin-D-interacting Myb-like protein 1, hDMTF1,
• Gene location: 7q21.12 (87152360: 87196331)     Exons: 24     NC_000007.14
• Gene summary(Entrez): This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathwa
• OMIM: 608491

Protein Summary

• Protein general information: Q9Y222  
  • Name: Cyclin D binding Myb like transcription factor 1 (hDMTF1) (Cyclin D interacting Myb like protein 1) (hDMP1)
  • Length: 760  
  • Mass: 84471
  • Tissue specificity: Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala,
• Sequence:

  MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVA
  LPLSENDQSFEVTMTATTEVADDEVTEGTVTQIQILQNEQLDEISPLGNEEVSAVSQAWFTTKEDKDSLTNKGHK
  WKQGMWSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRVLRMYDDRNHVG
  KYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEEEKRLAEVVHELTSTEPGDIV
  TQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILRIAELDVADENDINWDLLAEGWSSVR
  SPQWLRSKWWTIKRQIANHKDVSFPVLIKGLKQLHENQKNNPTLLENKSGSGVPNSNTNSSVQHVQIRVARLEDN
  TAISSSPMAALQIPVQITHVSSADSPATVDSETITLNSGTLQTFEILPSFHLQPTGTPGTYLLQTSSSQGLPLTL
  TASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDF
  PEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
  EGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDS
  KDVEDLVNCH

• Structural information:
  • Protein Domains: (225..26-)
    (/note="Myb-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00133-)
    (268..33-)
    (/note="HTH-myb-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00625-)
    (339..38-)
    (/note="Myb-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRu-)
  • Interpro: IPR009057  IPR017877  IPR017930  IPR001005  
  • Prosite: PS51294 PS50090
  • CDD: cd00167
  • PDB: 2LLK
  • PDBsum: 2LLK
  • STRING: ENSP00000378193
• Other Databases: GeneCards:  DMTF1  Malacards:  DMTF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0005634	nucleus	NAS	cellular component
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)