Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 998
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol CDC42   Gene   UCSC   Ensembl
Aliases CDC42Hs, G25K, TKS
Gene name cell division cycle 42
Alternate names cell division control protein 42 homolog, G25K GTP-binding protein, GTP binding protein, 25kDa, dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)), dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD)), growth-regulating protein, ,
Gene location 1p36.12 (22052626: 22092942)     Exons: 8     NC_000001.11
Gene summary(Entrez) The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly simila
OMIM 116952

Protein Summary
Protein general information P60953  

Name: Cell division control protein 42 homolog (G25K GTP binding protein)

Length: 191  Mass: 21,259

Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQT
DVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLK
AVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Structural information
Interpro:  IPR037874  IPR027417  IPR005225  IPR001806  IPR003578  
Prosite:   PS51420
CDD:   cd01874

PDB:  		 1A4R 1AJE 1AM4 1AN0 1CEE 1CF4 1DOA 1E0A 1EES 1GRN 1GZS 1KI1 1KZ7 1KZG 1NF3 2ASE 2DFK 2KB0 2NGR 2ODB 2QRZ 2WM9 2WMN 2WMO 3GCG 3QBV 3VHL 4DID 4ITR 4JS0 4YC7 4YDH 5CJP 5FI1 5HZK 5UPK 5UPL
PDBsum:   1A4R 1AJE 1AM4 1AN0 1CEE 1CF4 1DOA 1E0A 1EES 1GRN 1GZS 1KI1 1KZ7 1KZG 1NF3 2ASE 2DFK 2KB0 2NGR 2ODB 2QRZ 2WM9 2WMN 2WMO 3GCG 3QBV 3VHL 4DID 4ITR 4JS0 4YC7 4YDH 5CJP 5FI1 5HZK 5UPK 5UPL

DIP:  
31097
MINT:  
STRING:   ENSP00000314458
Other Databases GeneCards:  CDC42  Malacards:  CDC42

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000139 Golgi membrane
 ISS cellular component
GO:0000322 storage vacuole
 IEA cellular component
GO:0002040 sprouting angiogenesis
 IEA biological process
GO:0003161 cardiac conduction system
development
 IEA biological process
GO:0003334 keratinocyte development
 IEA biological process
GO:0003924 GTPase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005525 GTP binding
 IDA molecular function
GO:0005525 GTP binding
 IDA molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005815 microtubule organizing ce
nter
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005911 cell-cell junction
 IEA cellular component
GO:0005925 focal adhesion
 IDA cellular component
GO:0007030 Golgi organization
 ISS biological process
GO:0007088 regulation of mitotic nuc
lear division
 IEA biological process
GO:0007097 nuclear migration
 IEA biological process
GO:0007163 establishment or maintena
nce of cell polarity
 TAS biological process
GO:0007264 small GTPase mediated sig
nal transduction
 IEA biological process
GO:0007596 blood coagulation
 TAS biological process
GO:0010628 positive regulation of ge
ne expression
 IEA biological process
GO:0010629 negative regulation of ge
ne expression
 IEA biological process
GO:0016020 membrane
 IDA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0016567 protein ubiquitination
 IEA biological process
GO:0019901 protein kinase binding
 IDA molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0021762 substantia nigra developm
ent
 IEP biological process
GO:0030036 actin cytoskeleton organi
zation
 IDA biological process
GO:0030141 secretory granule
 IEA cellular component
GO:0030175 filopodium
 IDA cellular component
GO:0030225 macrophage differentiatio
n
 TAS biological process
GO:0030307 positive regulation of ce
ll growth
 IMP biological process
GO:0030496 midbody
 IDA cellular component
GO:0030742 GTP-dependent protein bin
ding
 IEA molecular function
GO:0031069 hair follicle morphogenes
is
 IEA biological process
GO:0031256 leading edge membrane
 IEA cellular component
GO:0031274 positive regulation of ps
eudopodium assembly
 IDA biological process
GO:0031295 T cell costimulation
 TAS biological process
GO:0031333 negative regulation of pr
otein complex assembly
 IPI biological process
GO:0031424 keratinization
 IEA biological process
GO:0031435 mitogen-activated protein
kinase kinase kinase bin
ding
 IEA molecular function
GO:0031647 regulation of protein sta
bility
 IEA biological process
GO:0031996 thioesterase binding
 IPI molecular function
GO:0032467 positive regulation of cy
tokinesis
 IMP biological process
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
 IEA biological process
GO:0034191 apolipoprotein A-I recept
or binding
 IPI molecular function
GO:0034332 adherens junction organiz
ation
 IEA biological process
GO:0034613 cellular protein localiza
tion
 IEA biological process
GO:0035088 establishment or maintena
nce of apical/basal cell
polarity
 IEA biological process
GO:0035264 multicellular organism gr
owth
 IEA biological process
GO:0036336 dendritic cell migration
 IEA biological process
GO:0036464 cytoplasmic ribonucleopro
tein granule
 IDA cellular component
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
 TAS biological process
GO:0042059 negative regulation of ep
idermal growth factor rec
eptor signaling pathway
 TAS biological process
GO:0042176 regulation of protein cat
abolic process
 IEA biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0043005 neuron projection
 IDA cellular component
GO:0043025 neuronal cell body
 IDA cellular component
GO:0043209 myelin sheath
 IEA cellular component
GO:0043497 regulation of protein het
erodimerization activity
 IEA biological process
GO:0043525 positive regulation of ne
uron apoptotic process
 IEA biological process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
 IEA biological process
GO:0045177 apical part of cell
 IEA cellular component
GO:0045740 positive regulation of DN
A replication
 IEA biological process
GO:0045859 regulation of protein kin
ase activity
 IEA biological process
GO:0046330 positive regulation of JN
K cascade
 IEA biological process
GO:0046847 filopodium assembly
 IEA biological process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
 TAS biological process
GO:0048013 ephrin receptor signaling
pathway
 TAS biological process
GO:0048664 neuron fate determination
 IEA biological process
GO:0051017 actin filament bundle ass
embly
 IEA biological process
GO:0051022 Rho GDP-dissociation inhi
bitor binding
 IEA molecular function
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
 TAS biological process
GO:0051149 positive regulation of mu
scle cell differentiation
 TAS biological process
GO:0051233 spindle midzone
 IDA cellular component
GO:0051489 regulation of filopodium
assembly
 IDA biological process
GO:0051683 establishment of Golgi lo
calization
 ISS biological process
GO:0051835 positive regulation of sy
napse structural plastici
ty
 IEA biological process
GO:0051988 regulation of attachment
of spindle microtubules t
o kinetochore
 IMP biological process
GO:0060047 heart contraction
 IEA biological process
GO:0060070 canonical Wnt signaling p
athway
 IEA biological process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
 NAS biological process
GO:0060501 positive regulation of ep
ithelial cell proliferati
on involved in lung morph
ogenesis
 IEA biological process
GO:0060661 submandibular salivary gl
and formation
 IEA biological process
GO:0060684 epithelial-mesenchymal ce
ll signaling
 IEA biological process
GO:0060789 hair follicle placode for
mation
 IEA biological process
GO:0061630 ubiquitin protein ligase
activity
 IDA molecular function
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0071338 positive regulation of ha
ir follicle cell prolifer
ation
 IEA biological process
GO:0072384 organelle transport along
microtubule
 ISS biological process
GO:0072686 mitotic spindle
 IDA cellular component
GO:0090135 actin filament branching
 IEA biological process
GO:0090136 epithelial cell-cell adhe
sion
 IEA biological process
GO:0090316 positive regulation of in
tracellular protein trans
port
 IEA biological process
GO:1900026 positive regulation of su
bstrate adhesion-dependen
t cell spreading
 IDA biological process
GO:0000139 Golgi membrane
 IEA cellular component
GO:0000139 Golgi membrane
 ISS cellular component
GO:0000166 nucleotide binding
 IEA molecular function
GO:0000322 storage vacuole
 IEA cellular component
GO:0001934 positive regulation of pr
otein phosphorylation
 IEA biological process
GO:0002040 sprouting angiogenesis
 IEA biological process
GO:0003161 cardiac conduction system
development
 IEA biological process
GO:0003334 keratinocyte development
 IEA biological process
GO:0003924 GTPase activity
 IEA molecular function
GO:0003924 GTPase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005525 GTP binding
 IEA molecular function
GO:0005525 GTP binding
 IEA molecular function
GO:0005525 GTP binding
 IEA molecular function
GO:0005525 GTP binding
 IDA molecular function
GO:0005525 GTP binding
 IDA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005815 microtubule organizing ce
nter
 IEA cellular component
GO:0005819 spindle
 IEA cellular component
GO:0005829 cytosol
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005911 cell-cell junction
 IEA cellular component
GO:0005925 focal adhesion
 IDA cellular component
GO:0006897 endocytosis
 IEA biological process
GO:0007015 actin filament organizati
on
 IEA biological process
GO:0007030 Golgi organization
 IEA biological process
GO:0007030 Golgi organization
 ISS biological process
GO:0007088 regulation of mitotic nuc
lear division
 IEA biological process
GO:0007097 nuclear migration
 IEA biological process
GO:0007163 establishment or maintena
nce of cell polarity
 TAS biological process
GO:0007264 small GTPase mediated sig
nal transduction
 IEA biological process
GO:0007399 nervous system developmen
t
 IEA biological process
GO:0007596 blood coagulation
 TAS biological process
GO:0010628 positive regulation of ge
ne expression
 IEA biological process
GO:0010629 negative regulation of ge
ne expression
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0016337 single organismal cell-ce
ll adhesion
 IEA biological process
GO:0016567 protein ubiquitination
 IEA biological process
GO:0019901 protein kinase binding
 IEA molecular function
GO:0019901 protein kinase binding
 IDA molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0021762 substantia nigra developm
ent
 IEP biological process
GO:0030036 actin cytoskeleton organi
zation
 IDA biological process
GO:0030141 secretory granule
 IEA cellular component
GO:0030154 cell differentiation
 IEA biological process
GO:0030175 filopodium
 IDA cellular component
GO:0030225 macrophage differentiatio
n
 TAS biological process
GO:0030307 positive regulation of ce
ll growth
 IMP biological process
GO:0030496 midbody
 IEA cellular component
GO:0030496 midbody
 IDA cellular component
GO:0030742 GTP-dependent protein bin
ding
 IEA molecular function
GO:0031069 hair follicle morphogenes
is
 IEA biological process
GO:0031256 leading edge membrane
 IEA cellular component
GO:0031274 positive regulation of ps
eudopodium assembly
 IDA biological process
GO:0031295 T cell costimulation
 TAS biological process
GO:0031333 negative regulation of pr
otein complex assembly
 IPI biological process
GO:0031424 keratinization
 IEA biological process
GO:0031435 mitogen-activated protein
kinase kinase kinase bin
ding
 IEA molecular function
GO:0031647 regulation of protein sta
bility
 IEA biological process
GO:0031996 thioesterase binding
 IPI molecular function
GO:0032467 positive regulation of cy
tokinesis
 IMP biological process
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
 IEA biological process
GO:0034191 apolipoprotein A-I recept
or binding
 IPI molecular function
GO:0034332 adherens junction organiz
ation
 IEA biological process
GO:0034613 cellular protein localiza
tion
 IEA biological process
GO:0035088 establishment or maintena
nce of apical/basal cell
polarity
 IEA biological process
GO:0035264 multicellular organism gr
owth
 IEA biological process
GO:0036336 dendritic cell migration
 IEA biological process
GO:0036464 cytoplasmic ribonucleopro
tein granule
 IDA cellular component
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
 TAS biological process
GO:0042059 negative regulation of ep
idermal growth factor rec
eptor signaling pathway
 TAS biological process
GO:0042176 regulation of protein cat
abolic process
 IEA biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042995 cell projection
 IEA cellular component
GO:0043005 neuron projection
 IDA cellular component
GO:0043025 neuronal cell body
 IDA cellular component
GO:0043209 myelin sheath
 IEA cellular component
GO:0043410 positive regulation of MA
PK cascade
 IEA biological process
GO:0043497 regulation of protein het
erodimerization activity
 IEA biological process
GO:0043525 positive regulation of ne
uron apoptotic process
 IEA biological process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
 IEA biological process
GO:0045177 apical part of cell
 IEA cellular component
GO:0045740 positive regulation of DN
A replication
 IEA biological process
GO:0045859 regulation of protein kin
ase activity
 IEA biological process
GO:0046330 positive regulation of JN
K cascade
 IEA biological process
GO:0046847 filopodium assembly
 IEA biological process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
 TAS biological process
GO:0048013 ephrin receptor signaling
pathway
 TAS biological process
GO:0048664 neuron fate determination
 IEA biological process
GO:0048730 epidermis morphogenesis
 IEA biological process
GO:0051017 actin filament bundle ass
embly
 IEA biological process
GO:0051022 Rho GDP-dissociation inhi
bitor binding
 IEA molecular function
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
 TAS biological process
GO:0051149 positive regulation of mu
scle cell differentiation
 TAS biological process
GO:0051233 spindle midzone
 IDA cellular component
GO:0051246 regulation of protein met
abolic process
 IEA biological process
GO:0051489 regulation of filopodium
assembly
 IDA biological process
GO:0051647 nucleus localization
 IEA biological process
GO:0051683 establishment of Golgi lo
calization
 IEA biological process
GO:0051683 establishment of Golgi lo
calization
 ISS biological process
GO:0051835 positive regulation of sy
napse structural plastici
ty
 IEA biological process
GO:0051988 regulation of attachment
of spindle microtubules t
o kinetochore
 IMP biological process
GO:0060047 heart contraction
 IEA biological process
GO:0060070 canonical Wnt signaling p
athway
 IEA biological process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
 NAS biological process
GO:0060501 positive regulation of ep
ithelial cell proliferati
on involved in lung morph
ogenesis
 IEA biological process
GO:0060661 submandibular salivary gl
and formation
 IEA biological process
GO:0060684 epithelial-mesenchymal ce
ll signaling
 IEA biological process
GO:0060789 hair follicle placode for
mation
 IEA biological process
GO:0061630 ubiquitin protein ligase
activity
 IDA molecular function
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0071338 positive regulation of ha
ir follicle cell prolifer
ation
 IEA biological process
GO:0071944 cell periphery
 IEA cellular component
GO:0072384 organelle transport along
microtubule
 IEA biological process
GO:0072384 organelle transport along
microtubule
 ISS biological process
GO:0072686 mitotic spindle
 IDA cellular component
GO:0090135 actin filament branching
 IEA biological process
GO:0090136 epithelial cell-cell adhe
sion
 IEA biological process
GO:0090316 positive regulation of in
tracellular protein trans
port
 IEA biological process
GO:1900026 positive regulation of su
bstrate adhesion-dependen
t cell spreading
 IDA biological process
GO:0000139 Golgi membrane
 ISS cellular component
GO:0003924 GTPase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005525 GTP binding
 IDA molecular function
GO:0005525 GTP binding
 IDA molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005925 focal adhesion
 IDA cellular component
GO:0007030 Golgi organization
 ISS biological process
GO:0007163 establishment or maintena
nce of cell polarity
 TAS biological process
GO:0007596 blood coagulation
 TAS biological process
GO:0016020 membrane
 IDA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0019901 protein kinase binding
 IDA molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0021762 substantia nigra developm
ent
 IEP biological process
GO:0030036 actin cytoskeleton organi
zation
 IDA biological process
GO:0030175 filopodium
 IDA cellular component
GO:0030225 macrophage differentiatio
n
 TAS biological process
GO:0030307 positive regulation of ce
ll growth
 IMP biological process
GO:0030496 midbody
 IDA cellular component
GO:0031274 positive regulation of ps
eudopodium assembly
 IDA biological process
GO:0031295 T cell costimulation
 TAS biological process
GO:0031333 negative regulation of pr
otein complex assembly
 IPI biological process
GO:0031996 thioesterase binding
 IPI molecular function
GO:0032467 positive regulation of cy
tokinesis
 IMP biological process
GO:0034191 apolipoprotein A-I recept
or binding
 IPI molecular function
GO:0036464 cytoplasmic ribonucleopro
tein granule
 IDA cellular component
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
 TAS biological process
GO:0042059 negative regulation of ep
idermal growth factor rec
eptor signaling pathway
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0043005 neuron projection
 IDA cellular component
GO:0043025 neuronal cell body
 IDA cellular component
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
 TAS biological process
GO:0048013 ephrin receptor signaling
pathway
 TAS biological process
GO:0051056 regulation of small GTPas
e mediated signal transdu
ction
 TAS biological process
GO:0051149 positive regulation of mu
scle cell differentiation
 TAS biological process
GO:0051233 spindle midzone
 IDA cellular component
GO:0051489 regulation of filopodium
assembly
 IDA biological process
GO:0051683 establishment of Golgi lo
calization
 ISS biological process
GO:0051988 regulation of attachment
of spindle microtubules t
o kinetochore
 IMP biological process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
 NAS biological process
GO:0061630 ubiquitin protein ligase
activity
 IDA molecular function
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0072384 organelle transport along
microtubule
 ISS biological process
GO:0072686 mitotic spindle
 IDA cellular component
GO:1900026 positive regulation of su
bstrate adhesion-dependen
t cell spreading
 IDA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04144Endocytosis
hsa04510Focal adhesion
hsa04520Adherens junction
hsa04530Tight junction
hsa04810Regulation of actin cytoskeleton
hsa04660T cell receptor signaling pathway
hsa04666Fc gamma R-mediated phagocytosis
hsa04670Leukocyte transendothelial migration
hsa04062Chemokine signaling pathway
hsa04912GnRH signaling pathway
hsa04722Neurotrophin signaling pathway
hsa04360Axon guidance
hsa05200Pathways in cancer
hsa05205Proteoglycans in cancer
hsa05203Viral carcinogenesis
hsa05212Pancreatic cancer
hsa05211Renal cell carcinoma
hsa04932Non-alcoholic fatty liver disease
hsa04933AGE-RAGE signaling pathway in diabetic complications
hsa05120Epithelial cell signaling in Helicobacter pylori infection
hsa05130Pathogenic Escherichia coli infection
hsa05132Salmonella infection
hsa05131Shigellosis
hsa05135Yersinia infection
hsa05100Bacterial invasion of epithelial cells
hsa05165Human papillomavirus infection

Diseases

Expand All | Collapse All
Associated diseases References
Multiple sclerosis GAD: 19667218
Amyotrophic lateral sclerosis (ALS) GAD: 17362836
Parkinson disease GAD: 18628988
Asthenozoospermia MIK: 23174138
Male factor infertility MIK: 23174138
Takenouchi-Kosaki syndrome OMIM: 116952
Hypospermatogenesis MIK: 28361989
Asthenozoospermia MIK: 23174138
Male infertility MIK: 23174138
Spermatogenic defects MIK: 27635527
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23174138 Idiopathic
asthenozo
ospermia,
male infer
tility
46 (25 inferti
le patients aff
ected by idiopa
thic asthenozoo
spermia, 21 age
-matched normos
permic fertile
donors)
 Male infertility Ezrin
 Cdc42
CD9
F-actin
and ?-tubulin
 Show abstract
27635527 Prevents a
ctin polym
erization
during cap
acitation,
Male infe
rtility

Male infertility
Show abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
28361989 Hyposperma
togenesis
6 (3 controls,
3 Klienfelter s
yndrome
 Male infertility Microarray
 Show abstract