• Gene id: 9978

Gene Summary

• Gene Symbol: RBX1   Gene   UCSC   Ensembl
• Aliases: BA554C12.1, RNF75, ROC1
• Gene name: ring-box 1
• Alternate names: E3 ubiquitin-protein ligase RBX1, E3 ubiquitin-protein transferase RBX1, RING finger protein 75, RING-box protein 1, ZYP protein, regulator of cullins 1, ring-box 1, E3 ubiquitin protein ligase,
• Gene location: 22q13.2 (40951377: 40973308)     Exons: 5     NC_000022.11
• Gene summary(Entrez): This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Re

Protein Summary

• Protein general information: P62877  
  • Name: E3 ubiquitin protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin protein ligase RBX1, N term
  • Length: 108  
  • Mass: 12274
  • Tissue specificity: Widely expressed.
• Sequence:

  MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVC
  NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

• Structural information:
  • Interpro: IPR001841  IPR013083  IPR024766  
  • Prosite: PS50089
  • PDB: 1LDJ 1LDK 1U6G 2HYE 2LGV 3DPL 3DQV 3RTR 4F52 4P5O 5N4W 6R6H 6R7F 6R7H 6R7I 6R7N
  • PDBsum: 1LDJ 1LDK 1U6G 2HYE 2LGV 3DPL 3DQV 3RTR 4F52 4P5O 5N4W 6R6H 6R7F 6R7H 6R7I 6R7N
  • DIP: 17014
  • STRING: ENSP00000216225
• Other Databases: GeneCards:  RBX1  Malacards:  RBX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0031461	cullin-RING ubiquitin ligase complex	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0097602	cullin family protein binding	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045116	protein neddylation	IDA	biological process
GO:0031465	Cul4B-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	cellular component
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	cellular component
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	cellular component
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0061663	NEDD8 ligase activity	IDA	molecular function
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0031467	Cul7-RING ubiquitin ligase complex	IDA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0019005	SCF ubiquitin ligase complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	IDA	molecular function
GO:0031461	cullin-RING ubiquitin ligase complex	IDA	cellular component
GO:0097602	cullin family protein binding	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0010265	SCF complex assembly	TAS	biological process
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006293	nucleotide-excision repair, preincision complex stabilization	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006295	nucleotide-excision repair, DNA incision, 3'-to lesion	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0019788	NEDD8 transferase activity	TAS	molecular function
GO:0019788	NEDD8 transferase activity	TAS	molecular function
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS	biological process
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0030163	protein catabolic process	IEA	biological process
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006513	protein monoubiquitination	IEA	biological process
GO:0030891	VCB complex	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0031466	Cul5-RING ubiquitin ligase complex	IDA	cellular component
GO:0031462	Cul2-RING ubiquitin ligase complex	IDA	cellular component
GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	cellular component
GO:0008134	transcription factor binding	IPI	molecular function
GO:0016567	protein ubiquitination	IPI	biological process
GO:0097602	cullin family protein binding	IPI	molecular function
GO:1902499	positive regulation of protein autoubiquitination	IMP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IPI	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05131	Shigellosis
hsa05170	Human immunodeficiency virus 1 infection
hsa04141	Protein processing in endoplasmic reticulum
hsa04310	Wnt signaling pathway
hsa04120	Ubiquitin mediated proteolysis
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04066	HIF-1 signaling pathway
hsa04350	TGF-beta signaling pathway
hsa05211	Renal cell carcinoma
hsa03420	Nucleotide excision repair
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq