• Gene id: 9976

Gene Summary

• Gene Symbol: CLEC2B   Gene   UCSC   Ensembl
• Aliases: AICL, CLECSF2, HP10085, IFNRG1
• Gene name: C-type lectin domain family 2 member B
• Alternate names: C-type lectin domain family 2 member B, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced), C-type lectin superfamily member 2, IFN-alpha-2b-inducing-related protein 1, IFN-alpha2b-inducing related pr,
• Gene location: 12p13.31 (9869858: 9852368)     Exons: 23     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
• OMIM: 603242

Protein Summary

• Protein general information: Q92478  
  • Name: C type lectin domain family 2 member B (Activation induced C type lectin) (C type lectin superfamily member 2) (IFN alpha 2b inducing related protein 1)
  • Length: 149  
  • Mass: 17307
  • Tissue specificity: Expressed preferentially in lymphoid tissues, and in most hematopoietic cell types.
• Sequence:

  MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDN
  IEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH

• Structural information:
  • Protein Domains: (42..14-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • DIP: 58612
  • STRING: ENSP00000228438
• Other Databases: GeneCards:  CLEC2B  Malacards:  CLEC2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05167	Kaposi sarcoma-associated herpesvirus infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Spermatogenic failure	MIK: 17921478
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
17921478	Spermatogenic failure			69 samples	Male infertility	Microarray