• Gene id: 997

Gene Summary

• Gene Symbol: CDC34   Gene   UCSC   Ensembl
• Aliases: E2-CDC34, UBC3, UBCH3, UBE2R1
• Gene name: cell division cycle 34, ubiqiutin conjugating enzyme
• Alternate names: ubiquitin-conjugating enzyme E2 R1, (E3-independent) E2 ubiquitin-conjugating enzyme R1, E2 ubiquitin-conjugating enzyme R1, cell division cycle 34 homolog, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2-32 KDA complementing, ubiquitin-conjugating e,
• Gene location: 19p13.3 (531719: 542087)     Exons: 6     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is requ
• OMIM: 116948

Protein Summary

• Protein general information: P49427  
  • Name: Ubiquitin conjugating enzyme E2 R1 (EC 2.3.2.23) ((E3 independent) E2 ubiquitin conjugating enzyme R1) (EC 2.3.2.24) (E2 ubiquitin conjugating enzyme R1) (Ubiquitin conjugating enzyme E2 32 kDa complementing) (Ubiquitin conjugating enzyme E2 CDC34) (Ubiqu
  • Length: 236  
  • Mass: 26737
  • Tissue specificity: Expressed in testes during spermatogenesis to regulate repression of cAMP-induced transcription. {ECO
• Sequence:

  MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAF
  RFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRK
  WKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFG
  DDEDDSGTEES

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 2OB4 3RZ3 4MDK
  • PDBsum: 2OB4 3RZ3 4MDK
  • DIP: 37783
  • STRING: ENSP00000215574
• Other Databases: GeneCards:  CDC34  Malacards:  CDC34

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0043951	negative regulation of cAMP-mediated signaling	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090261	positive regulation of inclusion body assembly	IEA	biological process
GO:0070848	response to growth factor	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0035458	cellular response to interferon-beta	IMP	biological process
GO:0006464	cellular protein modification process	NAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	NAS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0004842	ubiquitin-protein transferase activity	NAS	molecular function
GO:0016567	protein ubiquitination	NAS	biological process
GO:0006270	DNA replication initiation	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq