• Gene id: 9965

Gene Summary

• Gene Symbol: FGF19   Gene   UCSC   Ensembl
• Gene name: fibroblast growth factor 19
• Alternate names: fibroblast growth factor 19, FGF-19,
• Gene location: 11q13.3 (69704021: 69698237)     Exons: 3     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell
• OMIM: 173325

Protein Summary

• Protein general information: O95750  
  • Name: Fibroblast growth factor 19 (FGF 19)
  • Length: 216  
  • Mass: 24003
  • Tissue specificity: Expressed in fetal brain, cartilage, retina, and adult gall bladder. {ECO
• Sequence:

  MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQS
  AHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQ
  RQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

• Structural information:
  • Interpro: IPR035444  IPR002209  IPR008996  
  • Prosite: PS00247
  • CDD: cd00058
  • PDB: 1PWA 2P23 6NFJ
  • PDBsum: 1PWA 2P23 6NFJ
  • DIP: 6039
  • STRING: ENSP00000294312
• Other Databases: GeneCards:  FGF19  Malacards:  FGF19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IPI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0070858	negative regulation of bile acid biosynthetic process	IDA	biological process
GO:0046326	positive regulation of glucose import	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa05218	Melanoma

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray