• Gene id: 9958

Gene Summary

• Gene Symbol: USP15   Gene   UCSC   Ensembl
• Aliases: UNPH-2, UNPH4
• Gene name: ubiquitin specific peptidase 15
• Alternate names: ubiquitin carboxyl-terminal hydrolase 15, deubiquitinating enzyme 15, ubiquitin thioesterase 15, ubiquitin thiolesterase 15, ubiquitin-specific-processing protease 15,
• Gene location: 12q14.1 (62260339: 62416388)     Exons: 27     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the ubiquitin specific protease (USP) family of deubiquitinating enzymes. USP enzymes play critical roles in ubiquitin-dependent processes through polyubiquitin chain disassembly and hydrolysis of ubiquitin-substrate bonds. T
• OMIM: 603838

Protein Summary

• Protein general information: Q9Y4E8  
  • Name: Ubiquitin carboxyl terminal hydrolase 15 (EC 3.4.19.12) (Deubiquitinating enzyme 15) (Ubiquitin thioesterase 15) (Ubiquitin specific processing protease 15) (Unph 2) (Unph4)
  • Length: 981  
  • Mass: 112419
  • Tissue specificity: Expressed in skeletal muscle, kidney, heart, placenta, liver, thymus, lung, and ovary, with little or no expression in other tissues.
• Sequence:

  MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGD
  AQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTR
  RFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPS
  TPKSPGASNFSTLPKISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
  NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSG
  YQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCPE
  CAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPMQYKVVVPKIGNILDLCTALSALSGIPADKMIVTDI
  YNHRFHRIFAMDENLSSIMERDDIYVFEININRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRN
  NTEDKLYNLLLLRMCRYVKISTETEETEGSLHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSEN
  ENSQSEDSVGGDNDSENGLCTEDTCKGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFLA
  LDWDPDLKKRYFDENAAEDFEKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLW
  SLPPVLVVHLKRFSYSRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKD
  DGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENE
  NCMHTN

• Structural information:
  • Protein Domains: (7..11-)
    (/note="DUSP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00613-)
    (289..93-)
    (/note="USP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01035"-)
  • Interpro: IPR035927  IPR038765  IPR006615  IPR001394  IPR013792   IPR028135  IPR029071  IPR029346  IPR018200  IPR028889  
  • Prosite: PS51283 PS00972 PS00973 PS50235
  • PDB: 1W6V 3LMN 3PPA 3PV1 3T9L 4A3O 4A3P 5JJW 6CPM 6CRN 6DJ9 6GH9 6GHA 6ML1
  • PDBsum: 1W6V 3LMN 3PPA 3PV1 3T9L 4A3O 4A3P 5JJW 6CPM 6CRN 6DJ9 6GH9 6GHA 6ML1
  • DIP: 50239
  • STRING: ENSP00000280377
• Other Databases: GeneCards:  USP15  Malacards:  USP15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990380	Lys48-specific deubiquitinase activity	IDA	molecular function
GO:0035520	monoubiquitinated protein deubiquitination	IDA	biological process
GO:1900246	positive regulation of RIG-I signaling pathway	IDA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0035520	monoubiquitinated protein deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0061649	ubiquitin modification-dependent histone binding	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0030509	BMP signaling pathway	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035616	histone H2B conserved C-terminal lysine deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0016579	protein deubiquitination	IDA	biological process
GO:0060389	pathway-restricted SMAD protein phosphorylation	IMP	biological process
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0007179	transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0005160	transforming growth factor beta receptor binding	IPI	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	TAS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0071108	protein K48-linked deubiquitination	IEA	biological process
GO:1990380	Lys48-specific deubiquitinase activity	IDA	molecular function
GO:0035520	monoubiquitinated protein deubiquitination	IDA	biological process
GO:1900246	positive regulation of RIG-I signaling pathway	IDA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0035520	monoubiquitinated protein deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0061649	ubiquitin modification-dependent histone binding	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0030509	BMP signaling pathway	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035616	histone H2B conserved C-terminal lysine deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0016579	protein deubiquitination	IDA	biological process
GO:0060389	pathway-restricted SMAD protein phosphorylation	IMP	biological process
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0007179	transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0005160	transforming growth factor beta receptor binding	IPI	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	TAS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0071108	protein K48-linked deubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray