• Gene id: 9957

Gene Summary

• Gene Symbol: HS3ST1   Gene   UCSC   Ensembl
• Aliases: 3OST, 3OST1
• Gene name: heparan sulfate-glucosamine 3-sulfotransferase 1
• Alternate names: heparan sulfate glucosamine 3-O-sulfotransferase 1, 3-OST-1, h3-OST-1, heparan sulfate (glucosamine) 3-O-sulfotransferase 1, heparan sulfate 3-O-sulfotransferase 1, heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1, heparin-glucosamine 3-O-sulfotransferase,
• Gene location: 4p15.33 (11434397: 11393149)     Exons: 3     NC_000004.12
• Gene summary(Entrez): Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme
• OMIM: 182891

Protein Summary

• Protein general information: O14792  
  • Name: Heparan sulfate glucosamine 3 O sulfotransferase 1 (EC 2.8.2.23) (Heparan sulfate D glucosaminyl 3 O sulfotransferase 1) (3 OST 1) (Heparan sulfate 3 O sulfotransferase 1) (h3 OST 1)
  • Length: 307  
  • Mass: 35773
  • Tissue specificity: Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta. {ECO
• Sequence:

  MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLS
  LHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPS
  ERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPF
  PEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
  GRTFDWH

• Structural information:
  • Interpro: IPR037359  IPR027417  IPR000863  
  • PDB: 1ZRH
  • PDBsum: 1ZRH
  • STRING: ENSP00000002596
• Other Databases: GeneCards:  HS3ST1  Malacards:  HS3ST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0005796	Golgi lumen	TAS	cellular component
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IEA	molecular function
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq