• Gene id: 9956

Gene Summary

• Gene Symbol: HS3ST2   Gene   UCSC   Ensembl
• Aliases: 30ST2, 3OST2
• Gene name: heparan sulfate-glucosamine 3-sulfotransferase 2
• Alternate names: heparan sulfate glucosamine 3-O-sulfotransferase 2, 3-OST-2, h3-OST-2, heparan sulfate (glucosamine) 3-O-sulfotransferase 2, heparan sulfate 3-O-sulfotransferase 2, heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2, heparin-glucosamine 3-O-sulfotransferase,
• Gene location: 16p12.2 (22814161: 22916337)     Exons: 4     NC_000016.10
• Gene summary(Entrez): Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme
• OMIM: 604056

Protein Summary

• Protein general information: Q9Y278  
  • Name: Heparan sulfate glucosamine 3 O sulfotransferase 2 (EC 2.8.2.29) (Heparan sulfate D glucosaminyl 3 O sulfotransferase 2) (3 OST 2) (Heparan sulfate 3 O sulfotransferase 2) (h3 OST 2)
  • Length: 367  
  • Mass: 41501
  • Tissue specificity: Highly expressed in the brain and weakly expressed in the heart, placenta, lung and skeletal muscle. {ECO
• Sequence:

  MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDDLGRSRLLGAPRCLRGPSAGGQKLLQKSRPCDP
  SGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFF
  DRNYGRGLDWYRSLMPRTLESQITLEKTPSYFVTQEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDI
  PTFEGLSFRNRTLGLVDVSWNAIRIGMYVLHLESWLQYFPLAQIHFVSGERLITDPAGEMGRVQDFLGIKRFITD
  KHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE

• Structural information:
  • Interpro: IPR037359  IPR027417  IPR000863  
  • STRING: ENSP00000261374
• Other Databases: GeneCards:  HS3ST2  Malacards:  HS3ST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0033871	[heparan sulfate]-glucosamine 3-sulfotransferase 2 activity	IEA	molecular function
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0007623	circadian rhythm	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
lung cancer	PMID:12527896
pancreatic cancer	PMID:12527896
colon cancer	PMID:12527896
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)