• Gene id: 9955

Gene Summary

• Gene Symbol: HS3ST3A1   Gene   UCSC   Ensembl
• Aliases: 3-OST-3A, 3OST3A1
• Gene name: heparan sulfate-glucosamine 3-sulfotransferase 3A1
• Alternate names: heparan sulfate glucosamine 3-O-sulfotransferase 3A1, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1, heparan sulfate 3-O-sulfotransferase 3A1, heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, heparin-glucosamine 3-O-sulfotransferase,
• Gene location: 17p12 (169067076: 169096166)     Exons: 9     NC_000002.12
• Gene summary(Entrez): Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme
• OMIM: 604057

Protein Summary

• Protein general information: Q9Y663  
  • Name: Heparan sulfate glucosamine 3 O sulfotransferase 3A1 (EC 2.8.2.30) (Heparan sulfate D glucosaminyl 3 O sulfotransferase 3A1) (3 OST 3A) (Heparan sulfate 3 O sulfotransferase 3A1) (h3 OST 3A)
  • Length: 406  
  • Mass: 44900
  • Tissue specificity: Ubiquitous. Most abundant in heart and placenta, followed by liver and kidney. {ECO
• Sequence:

  MAPPGPASALSTSAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCQTLSGPVVGLSGGGEEAGAPGGGVLAGGP
  RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGTLALLLDEGSK
  QLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQITMEKTPSYFVTREA
  PARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLR
  HFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEI
  DREVVRRLREFYRPFNLKFYQMTGHDFGWDG

• Structural information:
  • Interpro: IPR037359  IPR027417  IPR000863  
  • PDB: 1T8T 1T8U
  • PDBsum: 1T8T 1T8U
  • STRING: ENSP00000284110
• Other Databases: GeneCards:  HS3ST3A1  Malacards:  HS3ST3A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0033872	[heparan sulfate]-glucosamine 3-sulfotransferase 3 activity	IEA	molecular function
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray