• Gene id: 9953

Gene Summary

• Gene Symbol: HS3ST3B1   Gene   UCSC   Ensembl
• Aliases: 3-OST-3B, 3OST3B1, h3-OST-3B
• Gene name: heparan sulfate-glucosamine 3-sulfotransferase 3B1
• Alternate names: heparan sulfate glucosamine 3-O-sulfotransferase 3B1, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1, heparan sulfate 3-O-sulfotransferase 3B1, heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1,
• Gene location: 17p12 (14301080: 14349405)     Exons: 4     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a type II integral membrane protein that belongs to the 3-O-sulfotransferases family. These proteins catalyze the addition of sulfate groups at the 3-OH position of glucosamine in heparan sulfate. The substrate specific

Protein Summary

• Protein general information: Q9Y662  
  • Name: Heparan sulfate glucosamine 3 O sulfotransferase 3B1 (EC 2.8.2.30) (Heparan sulfate D glucosaminyl 3 O sulfotransferase 3B1) (3 OST 3B) (Heparan sulfate 3 O sulfotransferase 3B1) (h3 OST 3B)
  • Length: 390  
  • Mass: 43324
  • Tissue specificity: Ubiquitous. Most abundant in liver and placenta, followed by heart and kidney. {ECO
• Sequence:

  MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPP
  ALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSKQLPQAIIIGVKKGGT
  RALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIV
  VVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERL
  ISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEIDREVVRRLREFYRPF
  NLKFYQMTGHDFGWD

• Structural information:
  • Interpro: IPR037359  IPR027417  IPR000863  
  • STRING: ENSP00000354213
• Other Databases: GeneCards:  HS3ST3B1  Malacards:  HS3ST3B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015012	heparan sulfate proteoglycan biosynthetic process	TAS	biological process
GO:0015015	heparan sulfate proteoglycan biosynthetic process, enzymatic modification	TAS	biological process
GO:0033872	[heparan sulfate]-glucosamine 3-sulfotransferase 3 activity	IEA	molecular function
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006477	protein sulfation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq