• Gene id: 9951

Gene Summary

• Gene Symbol: HS3ST4   Gene   UCSC   Ensembl
• Aliases: 3-OST-4, 30ST4, 3OST4, h3-OST-4
• Gene name: heparan sulfate-glucosamine 3-sulfotransferase 4
• Alternate names: heparan sulfate glucosamine 3-O-sulfotransferase 4, heparan sulfate (glucosamine) 3-O-sulfotransferase 4, heparan sulfate 3-O-sulfotransferase 4, heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4,
• Gene location: 16p12.1 (25691958: 26137684)     Exons: 2     NC_000016.10
• Gene summary(Entrez): This gene encodes the enzyme heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4. This enzyme generates 3-O-sulfated glucosaminyl residues in heparan sulfate. Cell surface heparan sulfate is used as a receptor by herpes simplex virus type 1 (HSV-1), and

Protein Summary

• Protein general information: Q9Y661  
  • Name: Heparan sulfate glucosamine 3 O sulfotransferase 4 (EC 2.8.2.23) (Heparan sulfate D glucosaminyl 3 O sulfotransferase 4) (3 OST 4) (Heparan sulfate 3 O sulfotransferase 4) (h3 OST 4)
  • Length: 456  
  • Mass: 49799
  • Tissue specificity: Brain-specific. {ECO
• Sequence:

  MARWPAPPPPPPPPPPLAAPPPPGASAKGPPARKLLFMCTLSLSVTYLCYSLLGGSGSLQFPLALQESPGAAAEP
  PPSPPPPSLLPTPVRLGAPSQPPAPPPLDNASHGEPPEPPEQPAAPGTDGWGLPSGGGGAQDAWLRTPLAPSEMI
  TAQSALPEREAQESSTTDEDLAGRRAANGSSERGGAVSTPDYGEKKLPQALIIGVKKGGTRALLEAIRVHPDVRA
  VGVEPHFFDRNYEKGLEWYRNVMPKTLDGQITMEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQ
  TLSKKPEIPTFEVLAFKNRTLGLIDASWSAIRIGIYALHLENWLQYFPLSQILFVSGERLIVDPAGEMAKVQDFL
  GLKRVVTEKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNLMFYQMTGQDFQWE
  QEEGDK

• Structural information:
  • Interpro: IPR037359  IPR027417  IPR000863  
  • STRING: ENSP00000330606
• Other Databases: GeneCards:  HS3ST4  Malacards:  HS3ST4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030201	heparan sulfate proteoglycan metabolic process	NAS	biological process
GO:0008467	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq