• Gene id: 9950

Gene Summary

• Gene Symbol: GOLGA5   Gene   UCSC   Ensembl
• Aliases: GOLIM5, RFG5, ret-II
• Gene name: golgin A5
• Alternate names: golgin subfamily A member 5, RET-fused gene 5 protein, cell proliferation-inducing gene 31 protein, golgi autoantigen, golgin subfamily a, 5, golgi integral membrane protein 5, golgin-84,
• Gene location: 14q32.12 (92794304: 92839946)     Exons: 13     NC_000014.9
• Gene summary(Entrez): The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be
• OMIM: 608021

Protein Summary

• Protein general information: Q8TBA6  
  • Name: Golgin subfamily A member 5 (Cell proliferation inducing gene 31 protein) (Golgin 84) (Protein Ret II) (RET fused gene 5 protein)
  • Length: 731  
  • Mass: 83024
  • Tissue specificity: Ubiquitous. Highly expressed in seminiferous tubules and Leydig cells in testis, and detected at much lower levels in the other tissues tested. Expression is very low or not detectable in spermatozoa. {ECO
• Sequence:

  MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNIRNQKA
  TILAGTANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVF
  QSSQTSSVSSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELS
  NLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQ
  LAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTFQERLHEADATLKREQESYKQMQSEF
  AARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLNLESSKQELIDYKQKATRILQSKEKLINSLK
  EGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIHQLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQK
  ASKQELETELERLKQEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQ
  KQTMLESLSTEKNSLVFQLERLEQQMNSASGSSSNGSSINMSGIDNGEGTRLRNVPVLFNDTETNLAGMYGKVRK
  AASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYTPEMHHDQPYGK

• Structural information:
  • Interpro: IPR019177  
  • STRING: ENSP00000163416
• Other Databases: GeneCards:  GOLGA5  Malacards:  GOLGA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031985	Golgi cisterna	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0017137	Rab GTPase binding	IDA	molecular function
GO:0005801	cis-Golgi network	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0007030	Golgi organization	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0048193	Golgi vesicle transport	IMP	biological process
GO:0007030	Golgi organization	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	IBA	cellular component
GO:0031985	Golgi cisterna	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0000301	retrograde transport, vesicle recycling within Golgi	IBA	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881