• Gene id: 995

Gene Summary

• Gene Symbol: CDC25C   Gene   UCSC   Ensembl
• Aliases: CDC25, PPP1R60
• Gene name: cell division cycle 25C
• Alternate names: M-phase inducer phosphatase 3, dual specificity phosphatase CDC25C, mitosis inducer CDC25, phosphotyrosine phosphatase, protein phosphatase 1, regulatory subunit 60,
• Gene location: 5q31.2 (138338354: 138285264)     Exons: 15     NC_000005.10
• Gene summary(Entrez): This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple al
• OMIM: 157680

Protein Summary

• Protein general information: P30307  
  • Name: M phase inducer phosphatase 3 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25C)
  • Length: 473  
  • Mass: 53,365
• Sequence:

  MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLS
  NLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSAN
  KENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPR
  LKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
  DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVF
  HCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQ
  SKVQEGERQLREQIALLVKDMSP

• Structural information:
  • Protein Domains: Rhodanese. (321-428)
  • Interpro: IPR000751  IPR001763  IPR036873  
  • Prosite: PS50206
  • CDD: cd01530
  • PDB: 2OJX 3BZI 3OP3 5M35 5M36 5M37
  • PDBsum: 2OJX 3BZI 3OP3 5M35 5M36 5M37
  • DIP: 24183
  • STRING: ENSP00000321656
• Other Databases: GeneCards:  CDC25C  Malacards:  CDC25C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IGI	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007088	regulation of mitotic nuclear division	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0016032	viral process	IEA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050699	WW domain binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IGI	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007088	regulation of mitotic nuclear division	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0016032	viral process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050699	WW domain binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IGI	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007088	regulation of mitotic nuclear division	TAS	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0050699	WW domain binding	IPI	molecular function
GO:0051726	regulation of cell cycle	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation
hsa05206	MicroRNAs in cancer
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Cancer (lung)	GAD: 18676680
Cancer (bladder)	GAD: 19692168
Cancer	GAD: 19626602
Cancer (leukemia)	GAD: 19074885
Cancer (esophageal)	GAD: 20453000
Cancer (breast)	GAD: 20508983
Male factor infertility	MIK: 16155078
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Male infertility	MIK: 16155078
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16155078	Male infertility			37 azoospermic patients	Male infertility	CDC2 CCNB1 CCNB2 CDC25A CDC25B CDC25C and WEE1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray