• Gene id: 9943

Gene Summary

• Gene Symbol: OXSR1   Gene   UCSC   Ensembl
• Aliases: OSR1
• Gene name: oxidative stress responsive kinase 1
• Alternate names: serine/threonine-protein kinase OSR1, oxidative stress responsive 1, oxidative stress-responsive 1 protein,
• Gene location: 3p22.2 (38165050: 38255485)     Exons: 23     NC_000003.12
• Gene summary(Entrez): The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq, Jul 2008]

Protein Summary

• Protein general information: O95747  
  • Name: Serine/threonine protein kinase OSR1 (EC 2.7.11.1) (Oxidative stress responsive 1 protein)
  • Length: 527  
  • Mass: 58022
  • Tissue specificity: Ubiquitously expressed in all tissue examined. {ECO
• Sequence:

  MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNI
  VSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKNGQIHRDVKAG
  NILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAA
  PYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFL
  QEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGKAAISQLRSPRVKESISNSELFPTT
  DPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
  RFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLS
  IS

• Structural information:
  • Protein Domains: (17..29-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR024678  IPR028749  IPR000719  IPR017441  
  • Prosite: PS00107 PS50011
  • PDB: 2V3S 2VWI 3DAK
  • PDBsum: 2V3S 2VWI 3DAK
  • DIP: 34977
  • STRING: ENSP00000311713
• Other Databases: GeneCards:  OXSR1  Malacards:  OXSR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0023016	signal transduction by trans-phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007231	osmosensory signaling pathway	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006979	response to oxidative stress	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901017	negative regulation of potassium ion transmembrane transporter activity	IEA	biological process
GO:0071476	cellular hypotonic response	IEA	biological process
GO:0038116	chemokine (C-C motif) ligand 21 signaling pathway	IEA	biological process
GO:1990869	cellular response to chemokine	IEA	biological process
GO:1901380	negative regulation of potassium ion transmembrane transport	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0038116	chemokine (C-C motif) ligand 21 signaling pathway	ISS	biological process
GO:0038146	chemokine (C-X-C motif) ligand 12 signaling pathway	IMP	biological process
GO:1990869	cellular response to chemokine	IMP	biological process
GO:0010820	positive regulation of T cell chemotaxis	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq