• Gene id: 9941

Gene Summary

• Gene Symbol: EXOG   Gene   UCSC   Ensembl
• Aliases: ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b, ENGLA, ENGLB
• Gene name: exo/endonuclease G
• Alternate names: nuclease EXOG, mitochondrial, endo G-like 1, endo/exonuclease (5'-3'), endonuclease G-like, endonuclease G-like 1, endonuclease G-like 2,
• Gene location: 3p22.2 (38496126: 38526304)     Exons: 12     NC_000003.12
• Gene summary(Entrez): This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell
• OMIM: 604063

Protein Summary

• Protein general information: Q9Y2C4  
  • Name: Nuclease EXOG, mitochondrial (EC 3.1.30. ) (Endonuclease G like 1) (Endo G like 1)
  • Length: 368  
  • Mass: 41085
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLTGTEAR
  CYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFS
  SKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVP
  SHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCK
  LLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS

• Structural information:
  • Interpro: IPR001604  IPR041003  IPR020821  IPR040255  
  • PDB: 4A1N 5T3V 5T40 5T4I 5T5C 5ZKI 5ZKJ 6IID
  • PDBsum: 4A1N 5T3V 5T40 5T4I 5T5C 5ZKI 5ZKJ 6IID
  • STRING: ENSP00000287675
• Other Databases: GeneCards:  EXOG  Malacards:  EXOG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004518	nuclease activity	IBA	molecular function
GO:0004519	endonuclease activity	IBA	molecular function
GO:0004521	endoribonuclease activity	IBA	molecular function
GO:0006309	apoptotic DNA fragmentation	IBA	biological process
GO:0000014	single-stranded DNA endodeoxyribonuclease activity	IBA	molecular function
GO:0000737	DNA catabolic process, endonucleolytic	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0008409	5'-3' exonuclease activity	IBA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0008409	5'-3' exonuclease activity	IDA	molecular function
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0004519	endonuclease activity	IDA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0008150	biological_process	ND	biological process
GO:0004519	endonuclease activity	NAS	molecular function

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray