• Gene id: 994

Gene Summary

• Gene Symbol: CDC25B   Gene   UCSC   Ensembl
• Gene name: cell division cycle 25B
• Alternate names: M-phase inducer phosphatase 2, dual specificity phosphatase Cdc25B,
• Gene location: 20p13 (3786771: 3806120)     Exons: 19     NC_000020.11
• Gene summary(Entrez): CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear loca
• OMIM: 605088

SNPs

rs2070565

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000021.9   g.44261270T>C
NC_000021.8   g.45681153T>C|SEQ=[T/C]|GENE=DNMT3L

rs2276248

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000021.9   g.44259375T>C
NC_000021.8   g.45679258T>C|SEQ=[T/C]|GENE=DNMT3L

rs7354779

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000021.9   g.44250887T>C
NC_000021.8   g.45670770T>C
NM_013369.3   c.832A>G
NM_013369.4   c.832A>G
NM_175867.2   c.832A>G
NM_175867.3   c.832A>G
NR_135514.1   n.75T>C
NP_037501.2   p.Arg278Gly
NP_787063.1   p.Arg278Gly|SEQ=[T/C]|GENE=DNMT3L
DNMT3L-AS1   1053728

rs1237691411

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.101737863A>G
NC_000012.11   g.102131641A>G
NG_021181.1   g.6607T>C
NM_153694.4   c.73T>C
NM_001177949.2   c.73T>C
NM_001177949.1   c.73T>C
NM_001177948.1   c.73T>C
XM_005268922.5   c.313T>C
XM_005268922.1   c.313T>C
XM_005268926.4   c.73T>C
XM_005268926  

Protein Summary

• Protein general information: P30305  
  • Name: M phase inducer phosphatase 2 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25B)
  • Length: 580  
  • Mass: 64987
• Sequence:

  MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETPKSQVG
  TLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQ
  SMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFA
  QRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
  LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKS
  LCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGH
  IKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGG
  YKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ

• Structural information:
  • Protein Domains: (431..53-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173"-)
  • Interpro: IPR000751  IPR001763  IPR036873  
  • Prosite: PS50206
  • CDD: cd01530
  • PDB: 1CWR 1CWS 1CWT 1QB0 1YM9 1YMD 1YMK 1YML 1YS0 2A2K 2IFD 2IFV 2UZQ 3FQT 3FQU 4WH7 4WH9
  • PDBsum: 1CWR 1CWS 1CWT 1QB0 1YM9 1YMD 1YMK 1YML 1YS0 2A2K 2IFD 2IFV 2UZQ 3FQT 3FQU 4WH7 4WH9
  • DIP: 323
  • STRING: ENSP00000245960
• Other Databases: GeneCards:  CDC25B  Malacards:  CDC25B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000086	G2/M transition of mitotic cell cycle	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IBA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0110032	positive regulation of G2/MI transition of meiotic cell cycle	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0045931	positive regulation of mitotic cell cycle	IMP	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:1902751	positive regulation of cell cycle G2/M phase transition	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001556	oocyte maturation	IEA	biological process
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0007144	female meiosis I	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0000278	mitotic cell cycle	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04110	Cell cycle
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Endometrial hyperplasia	PMID:14559803
Prostate cancer	PMID:12569365
urinary bladder cancer	PMID:19383904
Endometrial cancer	PMID:14559803
Vulva squamous cell carcinoma	PMID:20500813
Breast carcinoma	PMID:15550849
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq