• Gene id: 9937

Gene Summary

• Gene Symbol: DCLRE1A   Gene   UCSC   Ensembl
• Aliases: PSO2, SNM1, SNM1A
• Gene name: DNA cross-link repair 1A
• Alternate names: DNA cross-link repair 1A protein, DNA-crosslink repair gene SNM1, SNM1 homolog A,
• Gene location: 10q25.3 (113854393: 113834724)     Exons: 11     NC_000010.11
• Gene summary(Entrez): This gene encodes a conserved protein that is involved in the repair of DNA interstrand cross-links. DNA cross-links suppress transcription, replication, and DNA segregation. The encoded protein is a regulator of the mitotic cell cycle checkpoint. Alterna
• OMIM: 300127

Protein Summary

• Protein general information: Q6PJP8  
  • Name: DNA cross link repair 1A protein (SNM1 homolog A) (hSNM1) (hSNM1A)
  • Length: 1040  
  • Mass: 116400
  • Tissue specificity: Expressed in brain, heart, kidney, liver, pancreas, placenta and skeletal muscle. {ECO
• Sequence:

  MLEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNRKRAAEAKEVKDHEVPLGNAGCQTS
  VASSQNSSCGDGIQQTQDKETTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPR
  SETECPDGLLCTSTIPFHYKRYTHFLLAQSRAGDHPFSSPSPASGGSFSETKSGVLCSLEERWSSYQNQTDNSVS
  NDPLLMTQYFKKSPSLTEASEKISTHIQTSQQALQFTDFVENDKLVGVALRLANNSEHINLPLPENDFSDCEISY
  SPLQSDEDTHDIDEKPDDSQEQLFFTESSKDGSLEEDDDSCGFFKKRHGPLLKDQDESCPKVNSFLTRDKYDEGL
  YRFNSLNDLSQPISQNNESTLPYDLACTGGDFVLFPPALAGKLAASVHQATKAKPDEPEFHSAQSNKQKQVIEES
  SVYNQVSLPLVKSLMLKPFESQVEGYLSSQPTQNTIRKLSSENLNAKNNTNSACFCRKALEGVPVGKATILNTEN
  LSSTPAPKYLKILPSGLKYNARHPSTKVMKQMDIGVYFGLPPKRKEEKLLGESALEGINLNPVPSPNQKRSSQCK
  RKAEKSLSDLEFDASTLHESQLSVELSSERSQRQKKRCRKSNSLQEGACQKRSDHLINTESEAVNLSKVKVFTKS
  AHGGLQRGNKKIPESSNVGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAGLSKHFTFPVY
  CSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVMILFYLPNGTVILHTGDFRADPSMERS
  LLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTLNPHALVVCGTYSIGKEKVFLAIADVLGSKVGM
  SQEKYKTLQCLNIPEINSLITTDMCSSLVHLLPMMQINFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIAD
  VIPQTKGNISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTWKSRSTMEKYFREWKLEAGY

• Structural information:
  • Interpro: IPR011084  IPR036866  
  • Prosite: PS51908
  • PDB: 4B87 5AHR 5NZW 5NZX 5NZY 5Q1J 5Q1K 5Q1L 5Q1M 5Q1N 5Q1O 5Q1P 5Q1Q 5Q1R 5Q1S 5Q1T 5Q1U 5Q1V 5Q1W 5Q1X 5Q1Y 5Q1Z 5Q20 5Q22 5Q23 5Q24 5Q25 5Q26 5Q27 5Q28 5Q29 5Q2A 5Q2B 5Q2C 5Q2D 5Q2E 5Q2F 5Q2G 5Q2H 5Q2I 5Q2J 5Q2K 5Q2L 5Q2M 5Q2N 5Q2O 5Q2P 5Q2Q 5Q2R 5Q2S 5Q2T 5Q2U 5Q2V 5Q2W 5Q2X 5Q2Y 5Q2Z 5Q30 5Q31 5Q32 5Q33 5Q34 5Q35 5Q3
  • PDBsum: 4B87 5AHR 5NZW 5NZX 5NZY 5Q1J 5Q1K 5Q1L 5Q1M 5Q1N 5Q1O 5Q1P 5Q1Q 5Q1R 5Q1S 5Q1T 5Q1U 5Q1V 5Q1W 5Q1X 5Q1Y 5Q1Z 5Q20 5Q22 5Q23 5Q24 5Q25 5Q26 5Q27 5Q28 5Q29 5Q2A 5Q2B 5Q2C 5Q2D 5Q2E 5Q2F 5Q2G 5Q2H 5Q2I 5Q2J 5Q2K 5Q2L 5Q2M 5Q2N 5Q2O 5Q2P 5Q2Q 5Q2R 5Q2S 5Q2T 5Q2U 5Q2V 5Q2W 5Q2X 5Q2Y 5Q2Z 5Q30 5Q31 5Q32 5Q33 5Q34 5Q35 5Q3
  • STRING: ENSP00000355185
• Other Databases: GeneCards:  DCLRE1A  Malacards:  DCLRE1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035312	5'-3' exodeoxyribonuclease activity	IDA	molecular function
GO:0006303	double-strand break repair via nonhomologous end joining	IBA	biological process
GO:0036297	interstrand cross-link repair	IBA	biological process
GO:0000784	nuclear chromosome, telomeric region	IBA	cellular component
GO:0003684	damaged DNA binding	IBA	molecular function
GO:0031848	protection from non-homologous end joining at telomere	IBA	biological process
GO:0035312	5'-3' exodeoxyribonuclease activity	IBA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0036297	interstrand cross-link repair	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881