• Gene id: 9934

Gene Summary

• Gene Symbol: P2RY14   Gene   UCSC   Ensembl
• Aliases: BPR105, GPR105, P2Y14
• Gene name: purinergic receptor P2Y14
• Alternate names: P2Y purinoceptor 14, G protein coupled receptor for UDP-glucose, G-protein coupled receptor 105, P2Y(14) receptor, P2Y14 receptor, UDP-glucose receptor, purinergic receptor P2Y, G-protein coupled, 14,
• Gene location: 3q25.1 (151279166: 151212114)     Exons: 6     NC_000003.12
• Gene summary(Entrez): The product of this gene belongs to the family of G-protein coupled receptors, which contains several receptor subtypes with different pharmacological selectivity for various adenosine and uridine nucleotides. This receptor is a P2Y purinergic receptor fo

Protein Summary

• Protein general information: Q15391  
  • Name: P2Y purinoceptor 14 (P2Y14) (G protein coupled receptor 105) (UDP glucose receptor)
  • Length: 338  
  • Mass: 38971
  • Tissue specificity: Highest expression in the placenta, adipose tissue, stomach and intestine, intermediate levels in the brain, spleen, lung and heart, lowest levels in the kidney.
• Sequence:

  MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYLKNIVIADFVMSLTFP
  FKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRYYKIVKPLWTSFIQSVSYSKLLSVIVWMLML
  LLAVPNIILTNQSVREVTQIKCIELKSELGRKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNST
  SVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
  PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR005466  
  • Prosite: PS50262
  • PDB: 2B6V
  • PDBsum: 2B6V
  • STRING: ENSP00000308361
• Other Databases: GeneCards:  P2RY14  Malacards:  P2RY14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	NAS	biological process
GO:0045029	G protein-coupled UDP receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881