• Gene id: 9933

Gene Summary

• Gene Symbol: PUM3   Gene   UCSC   Ensembl
• Aliases: HA-8, HLA-HA8, KIAA0020, PEN, PUF-A, PUF6, XTP5
• Gene name: pumilio RNA binding family member 3
• Alternate names: pumilio homolog 3, HBV X-transactivated gene 5 protein, HBV XAg-transactivated protein 5, minor histocompatibility antigen HA-8, penguin homolog, protein 5 transactivated by hepatitis B virus X antigen (HBxAg),
• Gene location: 9p24.2 (2844094: 2804151)     Exons: 18     NC_000009.12
• OMIM: 603734

Protein Summary

• Protein general information: Q15397  
  • Name: Pumilio homolog 3 (HBV X transactivated gene 5 protein) (HBV XAg transactivated protein 5) (Minor histocompatibility antigen HA 8) (HLA HA8)
  • Length: 648  
  • Mass: 73584
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MEVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSRNFEKSITKLGKKGVKQFKNKQQGD
  KSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKWDDFKKKKKELKQSRQLSDKTNYDIVVRAKQMWEILRRKDC
  DKEKRVKLMSDLQKLIQGKIKTIAFAHDSTRVIQCYIQYGNEEQRKQAFEELRDDLVELSKAKYSRNIVKKFLMY
  GSKPQIAEIIRSFKGHVRKMLRHAEASAIVEYAYNDKAILEQRNMLTEELYGNTFQLYKSADHRTLDKVLEVQPE
  KLELIMDEMKQILTPMAQKEAVIKHSLVHKVFLDFFTYAPPKLRSEMIEAIREAVVYLAHTHDGARVAMHCLWHG
  TPKDRKVIVKTMKTYVEKVANGQYSHLVLLAAFDCIDDTKLVKQIIISEIISSLPSIVNDKYGRKVLLYLLSPRD
  PAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPALLSYLQEHAQEVVLDKSACVLVSDILGSATGDVQPT
  MNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGA
  IILSSLLQSCDLEVANKVKAALKSLIPTLEKTKSTSKGIEILLEKLST

• Structural information:
  • Protein Domains: (143..51-)
    (/note="PUM-HD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00318"-)
  • Interpro: IPR011989  IPR016024  IPR012959  IPR033133  IPR040059   IPR001313  
  • Prosite: PS50302 PS50303
  • PDB: 4WZR 4WZW
  • PDBsum: 4WZR 4WZW
  • STRING: ENSP00000380982
• Other Databases: GeneCards:  PUM3  Malacards:  PUM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0005730	nucleolus	IBA	cellular component
GO:0006417	regulation of translation	IBA	biological process
GO:0005694	chromosome	IDA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0010835	regulation of protein ADP-ribosylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881