• Gene id: 993

Gene Summary

• Gene Symbol: CDC25A   Gene   UCSC   Ensembl
• Aliases: CDC25A2
• Gene name: cell division cycle 25A
• Alternate names: M-phase inducer phosphatase 1, CDC25 isoform A1-CAG, CDC25A2-CAG isoform, dual specificity phosphatase CDC25A,
• Gene location: 3p21.31 (48188404: 48157177)     Exons: 15     NC_000003.12
• Gene summary(Entrez): CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in respons
• OMIM: 116947

Protein Summary

• Protein general information: P30304  
  • Name: M phase inducer phosphatase 1 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25A)
  • Length: 524  
  • Mass: 59,087
• Sequence:

  MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSNLQRMG
  SSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDENKENEAFEFKK
  PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGE
  NLKNEEETPSCMASLWTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
  ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYISPEIMASVLNGKFAN
  LIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPTDGKRVIVVFHCEFSSERGPRMCRYVRERDR
  LGNEYPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL

• Structural information:
  • Protein Domains: Rhodanese. (376-482)
  • Interpro: IPR000751  IPR001763  IPR036873  
  • Prosite: PS50206
  • CDD: cd01530
  • PDB: 1C25
  • PDBsum: 1C25
  • DIP: 166
  • STRING: ENSP00000303706
• Other Databases: GeneCards:  CDC25A  Malacards:  CDC25A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0009314	response to radiation	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0034644	cellular response to UV	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0009314	response to radiation	IDA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0034644	cellular response to UV	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0009314	response to radiation	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0034644	cellular response to UV	IDA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa04218	Cellular senescence
hsa04914	Progesterone-mediated oocyte maturation
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Cancer (esophageal)	GAD: 20453000
Cancer (ovarian)	GAD: 19738611
Cancer	GAD: 19692168
Cancer (breast)	GAD: 20614206
Cancer (lung)	GAD: 18676680
Cancer (bladder)	GAD: 19692168
Schizophrenia	GAD: 19367581
Spermatogenesis defects	MIK: 16720623
Male factor infertility	MIK: 19417033
Azoospermia	MIK: 16720623
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 16720623
Male infertility	MIK: 16155078
Spermatogenic defects	MIK: 25726377
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16155078	Male infertility			37 azoospermic patients	Male infertility	CDC2 CCNB1 CCNB2 CDC25A CDC25B CDC25C and WEE1
16720623	Azoospermia, spermatogenic failure, male infertility			40 azoospermic men	Male infertility
19417033	Male infertility			32 infertile men	Male infertility	BOLL CDC25A
25726377	Role in spermatogenesis				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881