• Gene id: 9928

Gene Summary

• Gene Symbol: KIF14   Gene   UCSC   Ensembl
• Aliases: MCPH20, MKS12
• Gene name: kinesin family member 14
• Alternate names: kinesin-like protein KIF14, epididymis secretory sperm binding protein,
• Gene location: 1q32.1 (21642301: 21644298)     Exons: 3     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the kinesin-3 superfamily of microtubule motor proteins. These proteins are involved in numerous processes including vesicle transport, chromosome segregation, mitotic spindle formation, and cytokinesis. In human HeLa-S3 and
• OMIM: 611279

Protein Summary

• Protein general information: Q15058  
  • Name: Kinesin like protein KIF14
  • Length: 1648  
  • Mass: 186492
• Sequence:

  MSLHSTHNRNNSGDILDIPSSQNSSSLNALTHSSRLKLHLKSDMSECENDDPLLRSAGKVRDINRTYVISASRKT
  ADMPLTPNPVGRLALQRRTTRNKESSLLVSELEDTTEKTAETRLTLQRRAKTDSAEKWKTAEIDSVKMTLNVGGE
  TENNGVSKESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLS
  QTEVVRSGHLTTKPTQSKLDIKVLGTGNLYHRSIGKEIAKTSNKFGSLEKRTPTKCTTEHKLTTKCSLPQLKSPA
  PSILKNRMSNLQVKQRPKSSFLANKQERSAENTILPEEETVVQNTSAGKDPLKVENSQVTVAVRVRPFTKREKIE
  KASQVVFMSGKEITVEHPDTKQVYNFIYDVSFWSFDECHPHYASQTTVYEKLAAPLLERAFEGFNTCLFAYGQTG
  SGKSYTMMGFSEEPGIIPRFCEDLFSQVARKQTQEVSYHIEMSFFEVYNEKIHDLLVCKDENGQRKQPLRVREHP
  VYGPYVEALSMNIVSSYADIQSWLELGNKQRATAATGMNDKSSRSHSVFTLVMTQTKTEFVEGEEHDHRITSRIN
  LIDLAGSERCSTAHTNGDRLKEGVSINKSLLTLGKVISALSEQANQRSVFIPYRESVLTWLLKESLGGNSKTAMI
  ATISPAASNIEETLSTLRYANQARLIVNIAKVNEDMNAKLIRELKAEIAKLKAAQRNSRNIDPERYRLCRQEITS
  LRMKLHQQERDMAEMQRVWKEKFEQAEKRKLQETKELQKAGIMFQMDNHLPNLVNLNEDPQLSEMLLYMIKEGTT
  TVGKYKPNSSHDIQLSGVLIADDHCTIKNFGGTVSIIPVGEAKTYVNGKHILEITVLRHGDRVILGGDHYFRFNH
  PVEVQKGKRPSGRDTPISEGPKDFEFAKNELLMAQRSQLEAEIKEAQLKAKEEMMQGIQIAKEMAQQELSSQKAA
  YESKIKALEAELREESQRKKMQEINNQKANHKIEELEKAKQHLEQEIYVNKKRLEMETLATKQALEDHSIRHARI
  LEALETEKQKIAKEVQILQQNRNNRDKTFTVQTTWSSMKLSMMIQEANAISSKLKTYYVFGRHDISDKSSSDTSI
  RVRNLKLGISTFWSLEKFESKLAAMKELYESNGSNRGEDAFCDPEDEWEPDITDAPVSSLSRRRSRSLMKNRRIS
  GCLHDIQVHPIKNLHSSHSSGLMDKSSTIYSNSAESFLPGICKELIGSSLDFFGQSYDEERTIADSLINSFLKIY
  NGLFAISKAHEEQDEESQDNLFSSDRAIQSLTIQTACAFEQLVVLMKHWLSDLLPCTNIARLEDELRQEVKKLGG
  YLQLFLQGCCLDISSMIKEAQKNAIQIVQQAVKYVGQLAVLKGSKLHFLENGNNKAASVQEEFMDAVCDGVGLGM
  KILLDSGLEKAKELQHELFRQCTKNEVTKEMKTNAMGLIRSLENIFAESKIKSFRRQVQEENFEYQDFKRMVNRA
  PEFLKLKHCLEKAIEIIISALKGCHSDINLLQTCVESIRNLASDFYSDFSVPSTSVGSYESRVTHIVHQELESLA
  KSLLFCFESEESPDLLKPWETYNQNTKEEHQQSKSSGIDGSKNKGVPKRVYELHGSSPAVSSEECTPSRIQWV

• Structural information:
  • Protein Domains: (358..70-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283-)
    (825..89-)
    (/note="FHA"-)
  • Interpro: IPR000253  IPR027640  IPR032405  IPR019821  IPR001752   IPR036961  IPR027417  IPR008984  
  • Prosite: PS00411 PS50067
  • CDD: cd00060
  • STRING: ENSP00000356319
• Other Databases: GeneCards:  KIF14  Malacards:  KIF14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030705	cytoskeleton-dependent intracellular transport	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005871	kinesin complex	IBA	cellular component
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0005874	microtubule	IBA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0051233	spindle midzone	IDA	cellular component
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0015631	tubulin binding	ISS	molecular function
GO:0008017	microtubule binding	ISS	molecular function
GO:0043523	regulation of neuron apoptotic process	ISS	biological process
GO:0021846	cell proliferation in forebrain	ISS	biological process
GO:0021772	olfactory bulb development	ISS	biological process
GO:0021766	hippocampus development	ISS	biological process
GO:0021695	cerebellar cortex development	ISS	biological process
GO:0021693	cerebellar Purkinje cell layer structural organization	ISS	biological process
GO:0021685	cerebellar granular layer structural organization	ISS	biological process
GO:0007019	microtubule depolymerization	ISS	NOT|biological process
GO:0001558	regulation of cell growth	IMP	biological process
GO:2000045	regulation of G1/S transition of mitotic cell cycle	IMP	biological process
GO:0010389	regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032147	activation of protein kinase activity	IMP	biological process
GO:0005886	plasma membrane	IPI	colocalizes with
GO:0016887	ATPase activity	ISS	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	ISS	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0031641	regulation of myelination	ISS	biological process
GO:0021987	cerebral cortex development	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045184	establishment of protein localization	IDA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0030165	PDZ domain binding	IDA	molecular function
GO:0005874	microtubule	IDA	cellular component
GO:0033624	negative regulation of integrin activation	IMP	biological process
GO:0030334	regulation of cell migration	IMP	biological process
GO:0030155	regulation of cell adhesion	IMP	biological process
GO:0032487	regulation of Rap protein signal transduction	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0031641	regulation of myelination	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0016887	ATPase activity	IEA	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:1903429	regulation of cell maturation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0043523	regulation of neuron apoptotic process	IEA	biological process
GO:0021846	cell proliferation in forebrain	IEA	biological process
GO:0021772	olfactory bulb development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021695	cerebellar cortex development	IEA	biological process
GO:0021693	cerebellar Purkinje cell layer structural organization	IEA	biological process
GO:0021685	cerebellar granular layer structural organization	IEA	biological process
GO:0015631	tubulin binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Primary microcephaly	KEGG:H00269
Meckel syndrome	KEGG:H00261
Retinoblastoma	KEGG:H01513
Primary microcephaly	KEGG:H00269
Meckel syndrome	KEGG:H00261
Retinoblastoma	KEGG:H01513
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq