• Gene id: 9924

Gene Summary

• Gene Symbol: PAN2   Gene   UCSC   Ensembl
• Aliases: USP52
• Gene name: poly(A) specific ribonuclease subunit PAN2
• Alternate names: PAN2-PAN3 deadenylation complex catalytic subunit PAN2, PAB-dependent poly(A)-specific ribonuclease subunit 2, PAB-dependent poly(A)-specific ribonuclease subunit PAN2, PAB1P-dependent poly(A)-nuclease, PAB1P-dependent poly(A)-specific ribonuclease, PABP-depen,
• Gene location: 12q13.3 (21948771: 20728519)     Exons: 14     NC_000004.12
• Gene summary(Entrez): This gene encodes a deadenylase that functions as the catalytic subunit of the polyadenylate binding protein dependent poly(A) nuclease complex. The encoded protein is a magnesium dependent 3' to 5' exoribonuclease that is involved in the degradation of c
• OMIM: 617447

Protein Summary

• Protein general information: Q504Q3  
  • Name: PAN2 PAN3 deadenylation complex catalytic subunit PAN2 (EC 3.1.13.4) (Inactive ubiquitin carboxyl terminal hydrolase 52) (PAB1P dependent poly(A) specific ribonuclease) (Poly(A) nuclease deadenylation complex subunit 2) (PAN deadenylation complex subunit
  • Length: 1202  
  • Mass: 135368
• Sequence:

  MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPSLLQNVELDPEGVALEALPVQESVHIMEGVYSELHSVVAEVGVP
  VSVSHFDLHEEMLWVGSHGGHATSFFGPALERYSSFQVNGSDDIRQIQSLENGILFLTKNNLKYMARGGLIIFDY
  LLDENEDMHSLLLTDSSTLLVGGLQNHIIEIDLNTVQETQKYAVETPGVTIMRQTNRFFFCGHTSGKVSLRDLRT
  FKVEHEFDAFSGSLSDFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRL
  AIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDSEGCVHLWTDSPEPSFNPYSRETEFA
  LPCLVDSLPPLDWSQDLLPLSLIPVPLTTDTLLSDWPAANSAPAPRRAPPVDAEILRTMKKVGFIGYAPNPRTRL
  RNQIPYRLKESDSEFDSFSQVTESPVGREEEPHLHMVSKKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPN
  AYCNCMIQVLYFLEPVRCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADS
  DEASGKGNLARLIQRWNRFILTQLHQDMQELEIPQAYRGAGGSSFCSSGDSVIGQLFSCEMENCSLCRCGSETVR
  ASSTLLFTLSYPDGSKSDKTGKNYDFAQVLKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDILVINCEVNSS
  KEADFWRMQAEVAFKMAVKKHGGEISKNKEFALADWKELGSPEGVLVCPSIEELKNVWLPFSIRMKMTKNKGLDV
  CNWTDGDEMQWGPARAEEEHGVYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEP
  IDKHEAVQFDMNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTFIPLMLNEMPQIGDLV
  GLDAEFVTLNEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDL
  DAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMISLRFLAWYFL
  DLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVL
  AL

• Structural information:
  • Protein Domains: (486..92-)
    (/note="USP-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03182-)
    (975..114-)
    (/note="Exonuclease-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03182"-)
  • Interpro: IPR013520  IPR030843  IPR028881  IPR038765  IPR012337   IPR036397  IPR028889  IPR015943  IPR036322  
  • Prosite: PS50235
  • DIP: 50708
  • STRING: ENSP00000401721
• Other Databases: GeneCards:  PAN2  Malacards:  PAN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	IBA	cellular component
GO:0031251	PAN complex	IBA	cellular component
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IBA	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IDA	molecular function
GO:0031251	PAN complex	IDA	cellular component
GO:0000175	3'-5'-exoribonuclease activity	IDA	molecular function
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0031251	PAN complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IKR	NOT|molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0004535	poly(A)-specific ribonuclease activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IEA	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IEA	biological process
GO:0031251	PAN complex	IEA	cellular component
GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881