• Gene id: 9913

Gene Summary

• Gene Symbol: SUPT7L   Gene   UCSC   Ensembl
• Aliases: SPT7L, STAF65, STAF65(gamma), STAF65G, SUPT7H
• Gene name: SPT7 like, STAGA complex subunit gamma
• Alternate names: STAGA complex 65 subunit gamma, SPT7 like, STAGA complex gamma subunit, SPTF-associated factor 65 gamma, STAF65gamma, STAGA complex 65 gamma subunit, adenocarcinoma antigen ART1, suppressor of Ty 7-like,
• Gene location: 2p23.3 (27663839: 27642567)     Exons: 3     NC_000002.12
• Gene summary(Entrez): SUPT7L is a protein subunit of the human STAGA complex (SPT3; (MIM 602947)/TAF9 (MIM 600822)/GCN5 (MIM 602301) acetyltransferase complex), which is a chromatin-modifying multiprotein complex (Martinez et al., 2001 [PubMed 11564863]).[supplied by OMIM, Apr
• OMIM: 612762

Protein Summary

• Protein general information: O94864  
  • Name: STAGA complex 65 subunit gamma (Adenocarcinoma antigen ART1) (SPTF associated factor 65 gamma) (STAF65gamma) (Suppressor of Ty 7 like)
  • Length: 414  
  • Mass: 46193
  • Tissue specificity: Expressed at high levels in adenocarcinomas and gliomas and low in esophageal cancers and malignant hematological disease. Also expressed at high level in the thymus, low in peripheral blood mononuclear cells, and lowest in the stomach
• Sequence:

  MNLQRYWGEIPISSSQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRR
  LRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSDPESDFYRGKGEPVTELS
  WHSCRQLLYQAVATILAHAGFDCANESVLETLTDVAHEYCLKFTKLLRFAVDREARLGQTPFPDVMEQVFHEVGI
  GSVLSLQKFWQHRIKDYHSYMLQISKQLSEEYERIVNPEKATEDAKPVKIKEEPVSDITFPVSEELEADLASGDQ
  SLPMGVLGAQSERFPSNLEVEASPQASSAEVNASPLWNLAHVKMEPQESEEGNVSGHGVLGSDVFEEPMSGMSEA
  GIPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCKKRMRKI

• Structural information:
  • Interpro: IPR006565  IPR009072  IPR039460  
  • STRING: ENSP00000336750
• Other Databases: GeneCards:  SUPT7L  Malacards:  SUPT7L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0051457	maintenance of protein location in nucleus	IDA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0030914	STAGA complex	IBA	cellular component
GO:0043966	histone H3 acetylation	IBA	biological process
GO:0004402	histone acetyltransferase activity	IBA	contributes to
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0030914	STAGA complex	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0030914	STAGA complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881