• Gene id: 991

Gene Summary

• Gene Symbol: CDC20   Gene   UCSC   Ensembl
• Aliases: CDC20A, bA276H19.3, p55CDC
• Gene name: cell division cycle 20
• Alternate names: cell division cycle protein 20 homolog, CDC20 cell division cycle 20 homolog, cell division cycle 20 homolog,
• Gene location: 1p34.2 (43358954: 43363202)     Exons: 11     NC_000001.11
• Gene summary(Entrez): CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by
• OMIM: 603618

SNPs

rs769423

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.3092923C>T
NC_000017.10   g.2996217C>T
NM_002548.2   c.74G>A
NP_002539.2   p.Arg25Gln|SEQ=[C/T]|GENE=OR1D2

rs5000770

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.80424141G>A
NC_000015.9   g.80716483G>A|SEQ=[G/A]|GENE=ARNT2

rs1020397

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.80426396G>A
NC_000015.10   g.80426396G>C
NC_000015.10   g.80426396G>T
NC_000015.9   g.80718738G>A
NC_000015.9   g.80718738G>C
NC_000015.9   g.80718738G>T|SEQ=[G/A/C/T]|GENE=ARNT2

Protein Summary

• Protein general information: Q12834  
  • Name: Cell division cycle protein 20 homolog (p55CDC)
  • Length: 499  
  • Mass: 54,723
• Sequence:

  MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPG
  GDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKV
  LYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQP
  GEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
  HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGG
  GTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLT
  MSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

• Structural information:
  • Interpro: IPR024977  IPR033187  IPR033010  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 4GGA 4GGC 4GGD 4N14 5G04 5KHR 5KHU 5LCW
  • PDBsum: 4GGA 4GGC 4GGD 4N14 5G04 5KHR 5KHU 5LCW
  • DIP: 29655
  • STRING: ENSP00000308450
• Other Databases: GeneCards:  CDC20  Malacards:  CDC20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000922	spindle pole	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005819	spindle	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007049	cell cycle	TAS	biological process
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0010997	anaphase-promoting complex binding	IEA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0031145	anaphase-promoting complex-dependent catabolic process	IDA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031915	positive regulation of synaptic plasticity	ISS	biological process
GO:0040020	regulation of meiotic nuclear division	IEA	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050773	regulation of dendrite development	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0090129	positive regulation of synapse maturation	ISS	biological process
GO:0097027	ubiquitin-protein transferase activator activity	IEA	molecular function
GO:1904668	positive regulation of ubiquitin protein ligase activity	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007049	cell cycle	TAS	biological process
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0010997	anaphase-promoting complex binding	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	IDA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031915	positive regulation of synaptic plasticity	IEA	biological process
GO:0031915	positive regulation of synaptic plasticity	ISS	biological process
GO:0040020	regulation of meiotic nuclear division	IEA	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043234	protein complex	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050773	regulation of dendrite development	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0090129	positive regulation of synapse maturation	IEA	biological process
GO:0090129	positive regulation of synapse maturation	ISS	biological process
GO:0097027	ubiquitin-protein transferase activator activity	IEA	molecular function
GO:1904668	positive regulation of ubiquitin protein ligase activity	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005819	spindle	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007049	cell cycle	TAS	biological process
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0031145	anaphase-promoting complex-dependent catabolic process	IDA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031915	positive regulation of synaptic plasticity	ISS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0090129	positive regulation of synapse maturation	ISS	biological process
GO:1904668	positive regulation of ubiquitin protein ligase activity	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa05203	Viral carcinogenesis
hsa05166	Human T-cell leukemia virus 1 infection

Diseases

Associated diseases	References
Cancer (ovarian)	GAD: 19738611
Cancer (breast)	GAD: 18172292
Azoospermia	MIK: 19426592
Chronic renal failure	GAD: 21085059
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 19426592
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19426592	Azoospermia				Male infertility	CDC10 CDC7L1 CDK9 CDC20 and CLK3
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray