• Gene id: 9908

Gene Summary

• Gene Symbol: G3BP2   Gene   UCSC   Ensembl
• Gene name: G3BP stress granule assembly factor 2
• Alternate names: ras GTPase-activating protein-binding protein 2, G3BP-2, GAP SH3 domain-binding protein 2, GTPase activating protein (SH3 domain) binding protein 2, Ras-GTPase activating protein SH3 domain-binding protein 2,
• Gene location: 4q21.1 (75724469: 75642768)     Exons: 17     NC_000004.12
• OMIM: 0

Protein Summary

• Protein general information: Q9UN86  
  • Name: Ras GTPase activating protein binding protein 2 (G3BP 2) (GAP SH3 domain binding protein 2)
  • Length: 482  
  • Mass: 54121
• Sequence:

  MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNDIHHKVLSLNFSECHT
  KIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFGDSEPELDEESE
  DEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKNLEELEEKS
  TTPPPAEPVSLPQEPPKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVEAKPEVQSQPPRVREQRPRERP
  GFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPNFG
  FVVFDDSEPVQRILIAKPIMFRGEVRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGIVGGGMMRDRD
  GRGPPPRGGMAQKLGSGRGTGQMEGRFTGQRR

• Structural information:
  • Protein Domains: (11..13-)
    (/note="NTF2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00137-)
    (331..40-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034377  IPR034376  IPR002075  IPR032710  IPR018222   IPR012677  IPR039539  IPR035979  IPR000504  
  • Prosite: PS50177 PS50102
  • CDD: cd00780 cd12464
  • PDB: 5DRV
  • PDBsum: 5DRV
  • DIP: 50299
  • STRING: ENSP00000352738
• Other Databases: GeneCards:  G3BP2  Malacards:  G3BP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0010494	cytoplasmic stress granule	IMP	cellular component
GO:0062029	positive regulation of stress granule assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051260	protein homooligomerization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034063	stress granule assembly	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0007253	cytoplasmic sequestering of NF-kappaB	NAS	biological process
GO:0030159	signaling receptor complex adaptor activity	NAS	molecular function
GO:0007265	Ras protein signal transduction	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005737	cytoplasm	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray