Male Infertility Database

Search Result

Gene id

9900

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

SV2A Gene UCSC Ensembl

Aliases

SV2

Gene name

synaptic vesicle glycoprotein 2A

Alternate names

synaptic vesicle glycoprotein 2A,

Gene location

1q21.2 (149917843: 149903317) Exons: 13 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons. [provided by RefSeq, Jun 2016]

Protein Summary

Protein general information

Q7L0J3

Name: Synaptic vesicle glycoprotein 2A

Length: 742 Mass: 82695

Sequence

MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEE
EGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQ
QYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGL
ADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLK
QVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMM
MGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVS
FEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVE
LYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFASAALALGSSLALKLPETRGQVLQ

Structural information

Interpro:	IPR001646 IPR011701 IPR020846 IPR005828 IPR036259 IPR005829 IPR022308
Prosite:	PS50850
PDB:	4V11
PDBsum:	4V11
MINT:
STRING:	ENSP00000358142

Other Databases

GeneCards: SV2A Malacards: SV2A

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0008021	synaptic vesicle	TAS	cellular component
GO:0019901	protein kinase binding	ISS	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0016021	integral component of mem brane	IBA	cellular component
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0007268	chemical synaptic transmi ssion	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0006836	neurotransmitter transpor t	IEA	biological process
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030285	integral component of syn aptic vesicle membrane	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0016082	synaptic vesicle priming	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0006874	cellular calcium ion home ostasis	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0014052	regulation of gamma-amino butyric acid secretion	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04512	ECM-receptor interaction

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All