• Gene id: 990

Gene Summary

• Gene Symbol: CDC6   Gene   UCSC   Ensembl
• Aliases: CDC18L, HsCDC18, HsCDC6, MGORS5
• Gene name: cell division cycle 6
• Alternate names: cell division control protein 6 homolog, CDC6 cell division cycle 6 homolog, CDC6-related protein, cdc18-related protein, cell division cycle 6 homolog, p62(cdc6),
• Gene location: 17q21.2 (40287877: 40304656)     Exons: 13     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc6, a protein essential for the initiation of DNA replication. This protein functions as a regulator at the early steps of DNA replication. It localizes in cell nucleus durin
• OMIM: 602627

Protein Summary

• Protein general information: Q99741  
  • Name: Cell division control protein 6 homolog (CDC6 related protein) (Cdc18 related protein) (HsCdc18) (p62(cdc6)) (HsCDC6)
  • Length: 560  
  • Mass: 62720
• Sequence:

  MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLGDDNLCNTPHLPPCSP
  PKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKILSSVRKSQEITTNSEQRCPLKKESACVRLF
  KQEGTCYQQAKLVLNTAVPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKG
  FKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTL
  FEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLNQVSRDQVLDNAAVQF
  CARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRMTLSQ
  EGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNK
  ETRLTKVFFKIEEKEIEHALKDKALIGNILATGLP

• Structural information:
  • Interpro: IPR003593  IPR041083  IPR016314  IPR015163  IPR027417   IPR036388  IPR036390  
  • CDD: cd08768
  • PDB: 2CCH 2CCI 4I5L 4I5N
  • PDBsum: 2CCH 2CCI 4I5L 4I5N
  • DIP: 28154
  • STRING: ENSP00000209728
• Other Databases: GeneCards:  CDC6  Malacards:  CDC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0033314	mitotic DNA replication checkpoint	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0006270	DNA replication initiation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	TAS	molecular function
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0007089	traversing start control point of mitotic cell cycle	TAS	biological process
GO:0000076	DNA replication checkpoint	TAS	biological process
GO:0008156	negative regulation of DNA replication	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904385	cellular response to angiotensin	IEA	biological process
GO:1904117	cellular response to vasopressin	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051233	spindle midzone	IDA	cellular component
GO:0051984	positive regulation of chromosome segregation	IDA	biological process
GO:0030071	regulation of mitotic metaphase/anaphase transition	IMP	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0000278	mitotic cell cycle	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
Meier-Gorlin syndrome	KEGG:H01889
Meier-Gorlin syndrome	KEGG:H01889
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray