Male Infertility Database

Search Result

Gene id

9899

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

SV2B Gene UCSC Ensembl

Aliases

HsT19680

Gene name

synaptic vesicle glycoprotein 2B

Alternate names

synaptic vesicle glycoprotein 2B, synaptic vesicle protein 2B homolog,

Gene location

15q26.1 (91099587: 91302564) Exons: 19 NC_000015.10

Gene summary(Entrez)

This gene encodes a member of the synaptic vesicle proteins 2 (SV2) family and major facilitator superfamily of proteins. This protein and other members of the family are localized to synaptic vesicles and may function in the regulation of vesicle traffic

OMIM

611425

Protein Summary

Protein general information

Q7L1I2

Name: Synaptic vesicle glycoprotein 2B

Length: 683 Mass: 77444

Sequence

MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVKAKQAKMAPSRMDSLR
GQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALMADGVEVFVVSFALPSAEKDMCLSSSKKGML
GMIVYLGMMAGAFILGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSE
FLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPCTVSMVALKFMPES
PRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFIEIQSSTGTWYQRWLVRFKTIFKQVW
DNALYCVMGPYRMNTLILAVVWFAMAFSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQ
HGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEG
CHMDLEQDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFC
GTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLP
ETREQVLM

Structural information

Interpro:	IPR001646 IPR011701 IPR020846 IPR005828 IPR036259 IPR005829 IPR022308
Prosite:	PS50850
STRING:	ENSP00000377779

Other Databases

GeneCards: SV2B Malacards: SV2B

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0008021	synaptic vesicle	TAS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0016021	integral component of mem brane	IBA	cellular component
GO:0007268	chemical synaptic transmi ssion	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0006836	neurotransmitter transpor t	IEA	biological process
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04512	ECM-receptor interaction

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
25753583	Unexplaine d infertil ity	46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All