• Gene id: 9890

Gene Summary

• Gene Symbol: PLPPR4   Gene   UCSC   Ensembl
• Aliases: LPPR4, LPR4, PHP1, PRG-1, PRG1
• Gene name: phospholipid phosphatase related 4
• Alternate names: phospholipid phosphatase-related protein type 4, brain-specific phosphatidic acid phosphatase-like protein 1, lipid phosphate phosphatase-related protein type 4, plasticity related gene 1, plasticity-related gene 1 protein,
• Gene location: 1p21.3-p21.2 (99262955: 99309583)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the lipid phosphate phosphatase (LPP) family. LPPs catalyze the dephosphorylation of a number of bioactive lipid mediators that regulate a variety of cell functions. This protein is specifically expressed in neu
• OMIM: 146731

Protein Summary

• Protein general information: Q7Z2D5  
  • Name: Phospholipid phosphatase related protein type 4 (EC 3.1.3.4) (Brain specific phosphatidic acid phosphatase like protein 1) (Lipid phosphate phosphatase related protein type 4) (Plasticity related gene 1 protein) (PRG 1)
  • Length: 763  
  • Mass: 82983
  • Tissue specificity: Specifically expressed in neurons. {ECO
• Sequence:

  MQRAGSSGGRGECDISGAGRLGLEEAARLSCAVHTSPGGGRRPGQAAGMSAKERPKGKVIKDSVTLLPCFYFVEL
  PILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLSLAFAGPAITIMVGEGILYCCLSK
  RRNGVGLEPNINAGGCNFNSFLRRAVRFVGVHVFGLCSTALITDIIQLSTGYQAPYFLTVCKPNYTSLNVSCKEN
  SYIVEDICSGSDLTVINSGRKSFPSQHATLAAFAAVYVSMYFNSTLTDSSKLLKPLLVFTFIICGIICGLTRITQ
  YKNHPVDVYCGFLIGGGIALYLGLYAVGNFLPSDESMFQHRDALRSLTDLNQDPNRLLSAKNGSSSDGIAHTEGI
  LNRNHRDASSLTNLKRANADVEIITPRSPMGKENMVTFSNTLPRANTPSVEDPVRRNASIHASMDSARSKQLLTQ
  WKNKNESRKLSLQVIEPEPGQSPPRSIEMRSSSEPSRVGVNGDHHGPGNQYLKIQPGAVPGCNNSMPGGPRVSIQ
  SRPGSSQLVHIPEETQENISTSPKSSSARAKWLKAAEKTVACNRSNSQPRIMQVIAMSKQQGVLQSSPKNTEGST
  VSCTGSIRYKTLTDHEPSGIVRVEAHPENNRPIIQIPSTEGEGSGSWKWKAPEKGSLRQTYELNDLNRDSESCES
  LKDSFGSGDRKRSNIDSNEHHHHGITTIRVTPVEGSEIGSETLSISSSRDSTLRRKGNIILIPERSNSPENTRNI
  FYKGTSPTRAYKD

• Structural information:
  • Interpro: IPR028684  IPR036938  IPR000326  
  • STRING: ENSP00000359204
• Other Databases: GeneCards:  PLPPR4  Malacards:  PLPPR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0008195	phosphatidate phosphatase activity	IBA	molecular function
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007409	axonogenesis	IBA	biological process
GO:0016791	phosphatase activity	IBA	molecular function
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0042577	lipid phosphatase activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0046839	phospholipid dephosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0048839	inner ear development	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R