• Gene id: 989

Gene Summary

• Gene Symbol: Sep-07   Gene   UCSC   Ensembl
• Aliases: CDC10, CDC3, NBLA02942, SEPT7A
• Gene name: septin 7
• Alternate names: septin-7, CDC10 (cell division cycle 10, S. cerevisiae, homolog), CDC10 protein homolog, septin 7 variant 4,
• Gene location: 7p14.2 (35800985: 35915762)     Exons: 19     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a G
• OMIM: 603151

Protein Summary

• Protein general information: Q16181  
  • Name: Septin 7 (CDC10 protein homolog)
  • Length: 437  
  • Mass: 50680
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDL
  YSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNR
  RQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEF
  PETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDV
  TNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDS
  EAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF

• Structural information:
  • Protein Domains: (47..31-)
    (/note="Septin-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01056"-)
  • Interpro: IPR030379  IPR027417  IPR016491  IPR008115  
  • Prosite: PS51719
  • CDD: cd01850
  • PDB: 2QAG 3T5D 3TW4 6N0B 6N12
  • PDBsum: 2QAG 3T5D 3TW4 6N0B 6N12
  • DIP: 47093
  • STRING: ENSP00000381992
• Other Databases: GeneCards:  Sep-07  Malacards:  Sep-07

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0000910	cytokinesis	TAS	biological process
GO:0001725	stress fiber	IDA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005930	axoneme	ISS	cellular component
GO:0005930	axoneme	IDA	cellular component
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016476	regulation of embryonic cell shape	ISS	biological process
GO:0030496	midbody	IEA	cellular component
GO:0031105	septin complex	IDA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0060271	cilium assembly	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1902857	positive regulation of non-motile cilium assembly	IMP	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0000910	cytokinesis	TAS	biological process
GO:0001725	stress fiber	IDA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005930	axoneme	ISS	cellular component
GO:0005930	axoneme	IDA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016476	regulation of embryonic cell shape	ISS	biological process
GO:0030496	midbody	IEA	cellular component
GO:0031105	septin complex	IEA	cellular component
GO:0031105	septin complex	IDA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0051301	cell division	IEA	biological process
GO:0060271	cilium assembly	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1902857	positive regulation of non-motile cilium assembly	IMP	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0000910	cytokinesis	TAS	biological process
GO:0001725	stress fiber	IDA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005930	axoneme	ISS	cellular component
GO:0005930	axoneme	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016476	regulation of embryonic cell shape	ISS	biological process
GO:0031105	septin complex	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0060271	cilium assembly	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1902857	positive regulation of non-motile cilium assembly	IMP	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0061640	cytoskeleton-dependent cytokinesis	IBA	biological process
GO:0060271	cilium assembly	IBA	biological process
GO:0032153	cell division site	IBA	cellular component
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0005940	septin ring	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0060090	molecular adaptor activity	IBA	molecular function
GO:0034613	cellular protein localization	IBA	biological process
GO:0031105	septin complex	IBA	cellular component
GO:0031105	septin complex	IDA	cellular component
GO:0097227	sperm annulus	IDA	cellular component
GO:0060271	cilium assembly	ISS	biological process
GO:0005930	axoneme	ISS	cellular component
GO:0016476	regulation of embryonic cell shape	ISS	biological process
GO:0016324	apical plasma membrane	ISS	colocalizes with
GO:0005525	GTP binding	IEA	molecular function
GO:0031105	septin complex	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0031105	septin complex	IDA	cellular component
GO:0005930	axoneme	IDA	cellular component
GO:1902857	positive regulation of non-motile cilium assembly	IMP	biological process
GO:0097730	non-motile cilium	IDA	cellular component
GO:0031105	septin complex	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis

Diseases

Associated diseases	References
Azoospermia	MIK: 19426592
Asthenozoospermia	MIK: 18951558
Absence correlated with multiple sperm defects	MIK: 20352323
Asthenozoospermia	MIK: 18951558
Azoospermia	MIK: 19426592
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19426592	Azoospermia				Male infertility	CDC10 CDC7L1 CDK9 CDC20 and CLK3
18951558	Asthenozoospermia			129 (108 infertile patients, 21 healthy volunteers were analyzed for sperm concentration and motility)	Male infertility	SEPT4 SEPT7
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R