• Gene id: 988

Gene Summary

• Gene Symbol: CDC5L   Gene   UCSC   Ensembl
• Aliases: CDC5, CDC5-LIKE, CEF1, PCDC5RP, dJ319D22.1
• Gene name: cell division cycle 5 like
• Alternate names: cell division cycle 5-like protein, CDC5 cell division cycle 5-like, Cdc5-related protein, dJ319D22.1 (CDC5-like protein), pombe cdc5-related protein,
• Gene location: 6p21.1 (44387705: 44450424)     Exons: 16     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cyc
• OMIM: 173510

Protein Summary

• Protein general information: Q99459  
  • Name: Cell division cycle 5 like protein (Cdc5 like protein) (Pombe cdc5 related protein)
  • Length: 802  
  • Mass: 92251
  • Tissue specificity: Ubiquitously expressed in both fetal and adult tissues. {ECO
• Sequence:

  MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLA
  KLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELE
  MLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFY
  DTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
  QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNV
  DTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNI
  NPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAI
  RDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
  KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQS
  RYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELR
  TFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

• Structural information:
  • Protein Domains: (1..5-)
    1 (/note="HTH-myb-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00625-)
    (57..10-)
    2 (/note="HTH-myb-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00625"-)
  • Interpro: IPR021786  IPR009057  IPR017930  IPR001005  
  • Prosite: PS51294
  • CDD: cd00167
  • PDB: 2DIM 2DIN 5MQF 5XJC 5YZG 5Z56 5Z57 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV
  • PDBsum: 2DIM 2DIN 5MQF 5XJC 5YZG 5Z56 5Z57 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV
  • DIP: 31731
  • STRING: ENSP00000360532
• Other Databases: GeneCards:  CDC5L  Malacards:  CDC5L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005662	DNA replication factor A complex	IDA	colocalizes with
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071987	WD40-repeat domain binding	IDA	molecular function
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000974	Prp19 complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0071007	U2-type catalytic step 2 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0072422	signal transduction involved in DNA damage checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001222	transcription corepressor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0071352	cellular response to interleukin-2	IEA	biological process
GO:1904568	cellular response to wortmannin	IEA	biological process
GO:1990646	cellular response to prolactin	IEA	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:0032993	protein-DNA complex	IEA	cellular component
GO:0043522	leucine zipper domain binding	IEA	molecular function
GO:0044344	cellular response to fibroblast growth factor stimulus	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003677	DNA binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Osteosarcoma	PMID:18567798
esophagus adenocarcinoma	PMID:15725809
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray