• Gene id: 9862

Gene Summary

• Gene Symbol: MED24   Gene   UCSC   Ensembl
• Aliases: ARC100, CRSP100, CRSP4, DRIP100, MED5, THRAP4, TRAP100
• Gene name: mediator complex subunit 24
• Alternate names: mediator of RNA polymerase II transcription subunit 24, CRSP complex subunit 4, activator-recruited cofactor 100 kDa component, cofactor required for Sp1 transcriptional activation subunit 4, cofactor required for Sp1 transcriptional activation, subunit 4, 10,
• Gene location: 17q21.1 (40054407: 40019103)     Exons: 27     NC_000017.11
• Gene summary(Entrez): This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activ
• OMIM: 612000

Protein Summary

• Protein general information: O75448  
  • Name: Mediator of RNA polymerase II transcription subunit 24 (Activator recruited cofactor 100 kDa component) (ARC100) (Cofactor required for Sp1 transcriptional activation subunit 4) (CRSP complex subunit 4) (Mediator complex subunit 24) (Thyroid hormone recep
  • Length: 989  
  • Mass: 110305
  • Tissue specificity: Ubiquitous. Abundant in skeletal muscle, heart and placenta. {ECO
• Sequence:

  MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSY
  SSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGT
  PAAGEKQLAMCLQRLEKTLSSTKNRALLHIAKLEEASSWTAIEHSLLKLGEILANLSNPQLRSQAEQCGTLIRSI
  PTMLSVHAEQMHKTGFPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVLEIWKACFVGLIESPEGT
  EELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCTNFLLQECGKQGLLSE
  ASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDL
  LLAAAAATGKLKSFARKFINLNEFTTYGSEESTKPASVRALLFDISFLMLCHVAQTYGSEVILSESRTGAEVPFF
  ETWMQTCMPEEGKILNPDHPCFRPDSTKVESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFE
  SIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMIRQLAGPLFSENTLQFYNERVVIMNSILERMCA
  DVLQQTATQIKFPSTGVDTMPYWNLLPPKRPIKEVLTDIFAKVLEKGWVDSRSIHIFDTLLHMGGVYWFCNNLIK
  ELLKETRKEHTLRAVELLYSIFCLDMQQVTLVLLGHILPGLLTDSSKWHSLMDPPGTALAKLAVWCALSSYSSHK
  GQASTRQKKRHREDIEDYISLFPLDDVQPSKLMRLLSSNEDDANILSSPTDRSMSSSLSASQLHTVNMRDPLNRV
  LANLFLLISSILGSRTAGPHTQFVQWFMEECVDCLEQGGRGSVLQFMPFTTVSELVKVSAMSSPKVVLAITDLSL
  PLGRQVAAKAIAAL

• Structural information:
  • Interpro: IPR021429  
  • DIP: 31462
  • STRING: ENSP00000377686
• Other Databases: GeneCards:  MED24  Malacards:  MED24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016592	mediator complex	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0016592	mediator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046966	thyroid hormone receptor binding	IDA	molecular function
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003712	transcription coregulator activity	IDA	molecular function
GO:0042809	vitamin D receptor binding	NAS	molecular function
GO:0016592	mediator complex	NAS	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray