• Gene id: 9860

Gene Summary

• Gene Symbol: LRIG2   Gene   UCSC   Ensembl
• Aliases: LIG-2, LIG2, UFS2
• Gene name: leucine rich repeats and immunoglobulin like domains 2
• Alternate names: leucine-rich repeats and immunoglobulin-like domains protein 2,
• Gene location: 1p13.2 (113073169: 113132259)     Exons: 21     NC_000001.11
• Gene summary(Entrez): This gene encodes a transmembrane protein containing leucine-rich repeats and immunoglobulin-like domains. The encoded protein promotes epidermal growth factor signalling, resulting in increased proliferation. Its expression in the cytoplasm of glioma cel
• OMIM: 158106

Protein Summary

• Protein general information: O94898  
  • Name: Leucine rich repeats and immunoglobulin like domains protein 2 (LIG 2)
  • Length: 1065  
  • Mass: 118965
  • Tissue specificity: Detected in all tissues analyzed. {ECO
• Sequence:

  MAPAPLGVPEEQLLGCRSRVLSRLLFIAQTALLLLPAAGAGLCPAPCSCRIPLLDCSRRKLPAPSWRALSGLLPP
  DTAILDFSHNRLSNWNISLESQTLQEVKMNYNELTEIPYFGEPTSNITLLSLVHNIIPEINAQALQFYPALESLD
  LSSNIISEIKTSSFPRMQLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRMSMIPPKIFKLPHLQFLELKRN
  RIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIE
  RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNEISWAI
  EDASEAFAGLTSLTKLILQGNQIKSITKKAFIGLESLEHLDLNNNAIMSIQENAFSQTHLKELILNTSSLLCDCH
  LKWLLQWLVDNNFQHSVNVSCAHPEWLAGQSILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSS
  DSPMSTVWRKDSEILYDVDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNE
  MPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVFFIANVKIEDMGIYSC
  MAQNTAGGLSANASLTVLETPSFIRPLEDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLVTERHFFAAANQL
  LIIVDAGLEDAGKYTCIMSNTLGTERGHIYLNVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWV
  IVIYHMRRKNEDYSITNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRV
  ICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESLIPSANREPSAFPTNH
  ERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHRLQDHAF
  DFSRTRNIQDGSEGT

• Structural information:
  • Protein Domains: (41..7-)
    (/note="LRRNT-)
    (443..49-)
    (/note="LRRCT-)
    (498..59-)
    1 (/note="Ig-like-C2-type)
    (602..69-)
    2 (/note="Ig-like-C2-type)
    (696..78-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR000483  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  
  • Prosite: PS50835 PS51450
  • STRING: ENSP00000355396
• Other Databases: GeneCards:  LRIG2  Malacards:  LRIG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097708	intracellular vesicle	IEA	cellular component
GO:0051045	negative regulation of membrane protein ectodomain proteolysis	IEA	biological process
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0010640	regulation of platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:2001222	regulation of neuron migration	IEA	biological process
GO:2000010	positive regulation of protein localization to cell surface	IEA	biological process
GO:0060384	innervation	IEA	biological process
GO:0048679	regulation of axon regeneration	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Urofacial syndrome	KEGG:H00753
Urofacial syndrome	KEGG:H00753
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881