• Gene id: 9840

Gene Summary

• Gene Symbol: TESPA1   Gene   UCSC   Ensembl
• Aliases: HSPC257, ITPRID3, KIAA0748
• Gene name: thymocyte expressed, positive selection associated 1
• Alternate names: protein TESPA1, thymocyte-expressed positive selection-associated protein 1,
• Gene location: 12q13.2 (54984761: 54948014)     Exons: 15     NC_000012.12
• OMIM: 615664

Protein Summary

• Protein general information: A2RU30  
  • Name: Protein TESPA1 (Thymocyte expressed positive selection associated protein 1)
  • Length: 521  
  • Mass: 59213
• Sequence:

  MEASVLSPTSWEKRRAWLRQSRNWQTQVLEEEAAAALQDVPDPEPSSLDDVFQEGNPINKIEDWLQDCGYSEEGF
  SEEAGQFIYNGFCSHGTSFEDDLTLGAEATLLAANGKLFSRSFLETARPCQLLDLGCSLASSSMTGGTNKTSSSI
  SEILDKVQEDAEDVLFSLGFGQEDHKDTSRIPARFFTTPSQAKGIDFQLFLKSQVRRIEMEDPCLMLASRFKQVQ
  TLAVTADAFFCLYSYVSKTPVQKFTPSHMFWNCNHPTDVPSIRILSREPEPQSPRDRLRKAISKMCLYTCPRDRP
  PPPHNTPKRNSLDQVVLEVMDKVKEEKQFLQQDSDLGQFSQEDPVPPAEGKKLPTSPYPCVFCCEEETQQRMSTV
  LAPSQTLDSNPKVPCCTHSLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLFQKNLMGR
  KVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQTFAGKDS

• Structural information:
  • Interpro: IPR029325  IPR026647  
  • STRING: ENSP00000400892
• Other Databases: GeneCards:  TESPA1  Malacards:  TESPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050862	positive regulation of T cell receptor signaling pathway	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0050862	positive regulation of T cell receptor signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0010387	COP9 signalosome assembly	IEA	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0050862	positive regulation of T cell receptor signaling pathway	IEA	biological process
GO:0033089	positive regulation of T cell differentiation in thymus	IEA	biological process
GO:0010387	COP9 signalosome assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0050862	positive regulation of T cell receptor signaling pathway	ISS	biological process
GO:0010387	COP9 signalosome assembly	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0033089	positive regulation of T cell differentiation in thymus	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)