• Gene id: 984

Gene Summary

• Gene Symbol: CDK11B   Gene   UCSC   Ensembl
• Aliases: CDC2L1, CDK11, CDK11-p110, CDK11-p46, CDK11-p58, CLK-1, PITSLREA, PK58, p58, p58CDC2L1, p58CLK-1
• Gene name: cyclin dependent kinase 11B
• Alternate names: cyclin-dependent kinase 11B, CDC-related protein kinase p58, PITSLRE serine/threonine-protein kinase CDC2L1, cell division cycle 2-like 1 (PITSLRE proteins), cell division protein kinase 11B, galactosyltransferase-associated protein kinase p58/GTA, p58 CLK-1,
• Gene location: 1p36.33 (1659618: 1635224)     Exons: 22     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighb
• OMIM: 611053

SNPs

rs11857513

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.50497226G>A
NC_000015.10   g.50497226G>C
NC_000015.9   g.50789423G>A
NC_000015.9   g.50789423G>C
NG_047101.1   g.77850G>A
NG_047101.1   g.77850G>C
NM_001128610.2   c.3033G>A
NM_001128610.2   c.3033G>C
NM_001128610.3   c.3033G>A
NM_001128610.3   c.3033G>

Protein Summary

• Protein general information: P21127  
  • Name: Cyclin dependent kinase 11B (EC 2.7.11.22) (Cell division cycle 2 like protein kinase 1) (CLK 1) (Cell division protein kinase 11B) (Galactosyltransferase associated protein kinase p58/GTA) (PITSLRE serine/threonine protein kinase CDC2L1) (p58 CLK 1)
  • Length: 795  
  • Mass: 92620
  • Tissue specificity: Expressed ubiquitously. Some evidence of isoform-specific tissue distribution. {ECO
• Sequence:

  MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMED
  RGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWER
  QKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDK
  VKASHWSRSPPRPPRERFELGDGRKPGEARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESG
  SGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEERENENHLLVVPES
  RFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQELPKYLPALQGCRSVEEFQCLNRIEEGTYG
  VVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKS
  LMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVT
  LWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDLGTPSEKIWPGYSELPAVKKMT
  FSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRG
  TSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF

• Structural information:
  • Protein Domains: (438..72-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • STRING: ENSP00000464036
• Other Databases: GeneCards:  CDK11B  Malacards:  CDK11B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0050684	regulation of mRNA processing	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0000278	mitotic cell cycle	NAS	biological process
GO:0001558	regulation of cell growth	IEP	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq