• Gene id: 983

Gene Summary

• Gene Symbol: CDK1   Gene   UCSC   Ensembl
• Aliases: CDC2, CDC28A, P34CDC2
• Gene name: cyclin dependent kinase 1
• Alternate names: cyclin-dependent kinase 1, cell cycle controller CDC2, cell division control protein 2 homolog, cell division cycle 2, G1 to S and G2 to M, cell division protein kinase 1, p34 protein kinase,
• Gene location: 10q21.2 (60778330: 60794851)     Exons: 9     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase trans
• OMIM: 116940

SNPs

rs553509

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.104013293T>C
NW_004070885.1   g.149709T>C
NG_016406.2   g.5396A>G
NM_001002916.4   c.368A>G
NC_000023.10   g.103267865C>T
NP_001002916.3   p.His123Arg|SEQ=[T/C]|GENE=H2BW1

rs7885967

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.104013669G>A
NW_004070885.1   g.150085G>A
NG_016406.2   g.5020C>T
NM_001002916.4   c.-9C>T
NC_000023.10   g.103268241G>A|SEQ=[G/A]|GENE=H2BW1

Protein Summary

• Protein general information: P06493  
  • Name: Cyclin dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase)
  • Length: 297  
  • Mass: 34,095
• Sequence:

  MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSR
  LYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLA
  RAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNN
  EVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

• Structural information:
  • Protein Domains: Protein (4-287)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1LC9 4Y72 4YC3 4YC6 5HQ0 5LQF
  • PDBsum: 1LC9 4Y72 4YC3 4YC6 5HQ0 5LQF
  • DIP: 35
  • STRING: ENSP00000378699
• Other Databases: GeneCards:  CDK1  Malacards:  CDK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0000226	microtubule cytoskeleton organization	TAS	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006461	protein complex assembly	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IEA	biological process
GO:0007098	centrosome cycle	TAS	biological process
GO:0007344	pronuclear fusion	TAS	biological process
GO:0007569	cell aging	IEA	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IDA	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0014038	regulation of Schwann cell differentiation	TAS	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0014075	response to amine	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016477	cell migration	TAS	biological process
GO:0016572	histone phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0030261	chromosome condensation	IEA	biological process
GO:0030332	cyclin binding	IEA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0033160	positive regulation of protein import into nucleus, translocation	IEA	biological process
GO:0034501	protein localization to kinetochore	IDA	biological process
GO:0035173	histone kinase activity	IDA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IEA	biological process
GO:0045995	regulation of embryonic development	TAS	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0055015	ventricular cardiac muscle cell development	IEA	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0072686	mitotic spindle	IDA	cellular component
GO:0090166	Golgi disassembly	ISS	biological process
GO:1900182	positive regulation of protein localization to nucleus	IMP	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0000226	microtubule cytoskeleton organization	TAS	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006461	protein complex assembly	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IEA	biological process
GO:0007098	centrosome cycle	TAS	biological process
GO:0007344	pronuclear fusion	TAS	biological process
GO:0007569	cell aging	IEA	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IEA	molecular function
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IDA	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0014038	regulation of Schwann cell differentiation	TAS	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0014075	response to amine	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016477	cell migration	TAS	biological process
GO:0016572	histone phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0030261	chromosome condensation	IEA	biological process
GO:0030332	cyclin binding	IEA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0033160	positive regulation of protein import into nucleus, translocation	IEA	biological process
GO:0034501	protein localization to kinetochore	IDA	biological process
GO:0035173	histone kinase activity	IEA	molecular function
GO:0035173	histone kinase activity	IDA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IEA	biological process
GO:0045995	regulation of embryonic development	TAS	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0055015	ventricular cardiac muscle cell development	IEA	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0072686	mitotic spindle	IDA	cellular component
GO:0090166	Golgi disassembly	IEA	biological process
GO:0090166	Golgi disassembly	ISS	biological process
GO:1900182	positive regulation of protein localization to nucleus	IMP	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0000226	microtubule cytoskeleton organization	TAS	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0007098	centrosome cycle	TAS	biological process
GO:0007344	pronuclear fusion	TAS	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IDA	molecular function
GO:0014038	regulation of Schwann cell differentiation	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016477	cell migration	TAS	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0034501	protein localization to kinetochore	IDA	biological process
GO:0035173	histone kinase activity	IDA	molecular function
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0045995	regulation of embryonic development	TAS	biological process
GO:0051436	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	TAS	biological process
GO:0051439	regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0090166	Golgi disassembly	ISS	biological process
GO:1900182	positive regulation of protein localization to nucleus	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04115	p53 signaling pathway
hsa04218	Cellular senescence
hsa04540	Gap junction
hsa04914	Progesterone-mediated oocyte maturation
hsa05203	Viral carcinogenesis
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Cancer (lung)	GAD: 19789190
Cancer (breast)	GAD: 18950845
Alzheimer's disease	GAD: 16192727
Male factor infertility	MIK: 16155078
Male infertility	MIK: 16155078
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16155078	Male infertility			37 azoospermic patients	Male infertility	CDC2 CCNB1 CCNB2 CDC25A CDC25B CDC25C and WEE1
26490841	Meiotic arrest in spermatocytes, Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R