• Gene id: 9827

Gene Summary

• Gene Symbol: RGP1   Gene   UCSC   Ensembl
• Aliases: KIAA0258
• Gene name: RGP1 homolog, RAB6A GEF complex partner 1
• Alternate names: RAB6A-GEF complex partner protein 2, RGP1 retrograde golgi transport homolog, retrograde Golgi transport protein RGP1 homolog,
• Gene location: 9p13.3 (35749286: 35758584)     Exons: 9     NC_000009.12
• OMIM: 615742

Protein Summary

• Protein general information: Q92546  
  • Name: RAB6A GEF complex partner protein 2 (Retrograde Golgi transport protein RGP1 homolog)
  • Length: 391  
  • Mass: 42455
• Sequence:

  MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPD
  SQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPIT
  LLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGT
  FGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTS
  FSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPT
  LASYAAPGPSTSTITI

• Structural information:
  • Interpro: IPR014848  
  • STRING: ENSP00000367318
• Other Databases: GeneCards:  RGP1  Malacards:  RGP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IBA	cellular component
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0017112	Rab guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0034066	RIC1-RGP1 guanyl-nucleotide exchange factor complex	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0017137	Rab GTPase binding	IDA	molecular function
GO:0034066	RIC1-RGP1 guanyl-nucleotide exchange factor complex	IDA	cellular component
GO:0017112	Rab guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:1903363	negative regulation of cellular protein catabolic process	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)