• Gene id: 9823

Gene Summary

• Gene Symbol: ARMCX2   Gene   UCSC   Ensembl
• Aliases: ALEX2, GASP9
• Gene name: armadillo repeat containing X-linked 2
• Alternate names: armadillo repeat-containing X-linked protein 2, ARM protein lost in epithelial cancers on chromosome X 2, armadillo repeat protein ALEX2,
• Gene location: Xq22.1 (101659877: 101655280)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes a protein containing a potential N-terminal transmembrane domain and multiple armadillo (arm) repeats. Proteins containing arm repeats are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is located
• OMIM: 300363

Protein Summary

• Protein general information: Q7L311  
  • Name: Armadillo repeat containing X linked protein 2 (ARM protein lost in epithelial cancers on chromosome X 2) (Protein ALEX2)
  • Length: 632  
  • Mass: 65683
  • Tissue specificity: Expressed at high levels ovary, heart, testis, prostate, brain, spleen and colon. Expressed at very low levels in liver and thymus. Not expressed in peripheral blood leukocytes. Not expressed in pancreas and ovarian carcinomas. {ECO
• Sequence:

  MSRVRDAGCVAAGIVIGAGAWYCVYKYTRGRDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPV
  RAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIAPPPGVTEALG
  AAEAPAMAGAPKVAEAPREAETSRAAVPPGTVVPTEAAAPTEVTEGPGVAAPTKVAEAPGVASPTEAAEAPVPAT
  PTGAAAPTGAAESPGTSGSPRTAVVPGTSAAKKATPGAHTGAIPKATSATGAVPKGGGKGVTRSRNGGKGKGKKS
  KVEVDELGMGFRPGDGAAAAAAASANGGQAFLAEVPDSEEGESGWTDTESDSDSEPETQRRGRGRRPVAMQKRPF
  PYEIDEILGVRDLRKVLALLQKSDDPFIQQVALLTLSNNANYSCNQETIRKLGGLPIIANMINKTDPHIKEKALM
  AMNNLSENYENQGRLQVYMNKVMDDIMASNLNSAVQVVGLKFLTNMTITNDYQHLLVNSIANFFRLLSQGGGKIK
  VEILKILSNFAENPDMLKKLLSTQVPASFSSLYNSYVESEILINALTLFEIIYDNLRAEVFNYREFNKGSLFYLC
  TTSGVCVKKIRALANHHDLLVKVKVIKLVNKF

• Structural information:
  • Interpro: IPR011989  IPR006911  IPR016024  IPR000225  
  • STRING: ENSP00000331662
• Other Databases: GeneCards:  ARMCX2  Malacards:  ARMCX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881