• Gene id: 9806

Gene Summary

• Gene Symbol: SPOCK2   Gene   UCSC   Ensembl
• Aliases: testican-2
• Gene name: SPARC (osteonectin), cwcv and kazal like domains proteoglycan 2
• Alternate names: testican-2, SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2, SPARC/osteonectin, cwcv and kazal like domains proteoglycan 2, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2,
• Gene location: 10q22.1 (72095312: 72059033)     Exons: 14     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein which binds with glycosaminoglycans to form part of the extracellular matrix. The protein contains thyroglobulin type-1, follistatin-like, and calcium-binding domains, and has glycosaminoglycan attachment sites in the acidic C-
• OMIM: 607988

Protein Summary

• Protein general information: Q92563  
  • Name: Testican 2 (SPARC/osteonectin, CWCV, and Kazal like domains proteoglycan 2)
  • Length: 424  
  • Mass: 46779
  • Tissue specificity: Highly expressed in brain. Also found in lung and testis. {ECO
• Sequence:

  MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYIKSWED
  NQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRIKQPTVKLHGNKDSICKPCHMAQLASVCGS
  DGHTYSSVCKLEQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQN
  GSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTA
  EWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHGSPD
  CDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDGGYIW

• Structural information:
  • Protein Domains: (130..18-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (310..37-)
    (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
  • Interpro: IPR011992  IPR002350  IPR036058  IPR019577  IPR000716   IPR036857  
  • Prosite: PS51465 PS00484 PS51162
  • CDD: cd00191
  • STRING: ENSP00000362201
• Other Databases: GeneCards:  SPOCK2  Malacards:  SPOCK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000147	positive regulation of cell motility	TAS	biological process
GO:0008191	metalloendopeptidase inhibitor activity	TAS	molecular function
GO:0010951	negative regulation of endopeptidase activity	TAS	biological process
GO:0050840	extracellular matrix binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0005509	calcium ion binding	IBA	molecular function
GO:0048856	anatomical structure development	IBA	biological process
GO:0005518	collagen binding	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0005539	glycosaminoglycan binding	IEA	molecular function
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	IEA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0045595	regulation of cell differentiation	NAS	biological process
GO:0007416	synapse assembly	NAS	biological process
GO:0031012	extracellular matrix	NAS	cellular component
GO:0030198	extracellular matrix organization	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq