• Gene id: 9804

Gene Summary

• Gene Symbol: TOMM20   Gene   UCSC   Ensembl
• Aliases: MAS20, MOM19, TOM20
• Gene name: translocase of outer mitochondrial membrane 20
• Alternate names: mitochondrial import receptor subunit TOM20 homolog, mitochondrial 20 kDa outer membrane protein, outer mitochondrial membrane receptor Tom20, translocase of outer mitochondrial membrane 20 homolog type II,
• Gene location: 1q42.3 (235128836: 235109340)     Exons: 14     NC_000001.11
• OMIM: 601848

Protein Summary

• Protein general information: Q15388  
  • Name: Mitochondrial import receptor subunit TOM20 homolog (Mitochondrial 20 kDa outer membrane protein) (Outer mitochondrial membrane receptor Tom20)
  • Length: 145  
  • Mass: 16298
• Sequence:

  MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQ
  LGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

• Structural information:
  • Interpro: IPR002056  IPR022422  IPR023392  
  • PDB: 4APO
  • PDBsum: 4APO
  • DIP: 46735
  • STRING: ENSP00000355566
• Other Databases: GeneCards:  TOMM20  Malacards:  TOMM20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006626	protein targeting to mitochondrion	IDA	biological process
GO:0015450	P-P-bond-hydrolysis-driven protein transmembrane transporter activity	IDA	molecular function
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005742	mitochondrial outer membrane translocase complex	TAS	cellular component
GO:0030943	mitochondrion targeting sequence binding	IBA	molecular function
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0016031	tRNA import into mitochondrion	IBA	biological process
GO:0005742	mitochondrial outer membrane translocase complex	IBA	cellular component
GO:0070096	mitochondrial outer membrane translocase complex assembly	IBA	biological process
GO:0031307	integral component of mitochondrial outer membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005742	mitochondrial outer membrane translocase complex	IEA	cellular component
GO:0006605	protein targeting	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0044233	mitochondria-associated endoplasmic reticulum membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005740	mitochondrial envelope	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:1905242	response to 3,3',5-triiodo-L-thyronine	IEA	biological process
GO:0030943	mitochondrion targeting sequence binding	IEA	molecular function
GO:0014850	response to muscle activity	IEA	biological process
GO:0006626	protein targeting to mitochondrion	IEA	biological process
GO:0005742	mitochondrial outer membrane translocase complex	TAS	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005742	mitochondrial outer membrane translocase complex	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq