• Gene id: 9798

Gene Summary

• Gene Symbol: IST1   Gene   UCSC   Ensembl
• Aliases: CHMP8, OLC1
• Gene name: IST1 factor associated with ESCRT-III
• Alternate names: IST1 homolog, IST1, ESCRT-III associated factor, IST1, endosomal sorting complex required for transport-III component, increased sodium tolerance 1 homolog, overexpressed in lung cancer 1, putative MAPK-activating protein PM28,
• Gene location: 16q22.2 (59175871: 59247773)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein with MIT-interacting motifs that interacts with components of endosomal sorting complexes required for transport (ESCRT). ESCRT functions in vesicle budding, such as that which occurs during membrane abscission in cytokinesis.
• OMIM: 616434

Protein Summary

• Protein general information: P53990  
  • Name: IST1 homolog (hIST1) (Putative MAPK activating protein PM28)
  • Length: 364  
  • Mass: 39751
• Sequence:

  MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELY
  CDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMH
  KLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPD
  GTVPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGP
  GPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKKT

• Structural information:
  • Interpro: IPR005061  IPR042277  
  • PDB: 3FRR 3FRS 3JC1 4U7E 4U7I 4U7Y 4WZX 6E8G
  • PDBsum: 3FRR 3FRS 3JC1 4U7E 4U7I 4U7Y 4WZX 6E8G
  • DIP: 42546
  • STRING: ENSP00000438399
• Other Databases: GeneCards:  IST1  Malacards:  IST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000785	chromatin	IDA	colocalizes with
GO:1904903	ESCRT III complex disassembly	NAS	biological process
GO:0036258	multivesicular body assembly	NAS	biological process
GO:0008104	protein localization	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048672	positive regulation of collateral sprouting	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0030496	midbody	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0009838	abscission	IDA	biological process
GO:0009838	abscission	IDA	biological process
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0046745	viral capsid secondary envelopment	IDA	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0019076	viral release from host cell	IDA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045184	establishment of protein localization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0090541	MIT domain binding	IPI	molecular function
GO:0090541	MIT domain binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0008104	protein localization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090541	MIT domain binding	IPI	molecular function
GO:0051301	cell division	IMP	biological process
GO:0009838	abscission	IMP	biological process
GO:0051301	cell division	IMP	biological process
GO:0051301	cell division	IMP	biological process
GO:0061640	cytoskeleton-dependent cytokinesis	IMP	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)