• Gene id: 9792

Gene Summary

• Gene Symbol: SERTAD2   Gene   UCSC   Ensembl
• Aliases: Sei-2, TRIP-Br2, TRIPBR2
• Gene name: SERTA domain containing 2
• Alternate names: SERTA domain-containing protein 2, transcriptional regulator interacting with the PHD-bromodomain 2, transcriptional regulator interacting with the PHS-bromodomain 2,
• Gene location: 2p14 (64751085: 64631620)     Exons: 4     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q14140  
  • Name: SERTA domain containing protein 2 (Transcriptional regulator interacting with the PHD bromodomain 2) (TRIP Br2)
  • Length: 314  
  • Mass: 33897
  • Tissue specificity: Expressed in adipose tissue. {ECO
• Sequence:

  MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEE
  LKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDDDTFCTSQAMQ
  PTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSL
  PGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAPYSSQPVTPSQPFKMD
  LTELDHIMEVLVGS

• Structural information:
  • Protein Domains: (33..8-)
    (/note="SERTA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00396"-)
  • Interpro: IPR009263  
  • Prosite: PS51053
  • STRING: ENSP00000326933
• Other Databases: GeneCards:  SERTAD2  Malacards:  SERTAD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048096	chromatin-mediated maintenance of transcription	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)