• Gene id: 9789

Gene Summary

• Gene Symbol: SPCS2   Gene   UCSC   Ensembl
• Gene name: signal peptidase complex subunit 2
• Alternate names: signal peptidase complex subunit 2, SPase 25 kDa subunit, microsomal signal peptidase 25 kDa subunit, signal peptidase 25kDa subunit, signal peptidase complex subunit 2 homolog,
• Gene location: 11q13.4 (74949265: 74979032)     Exons: 5     NC_000011.10

Protein Summary

• Protein general information: Q15005  
  • Name: Signal peptidase complex subunit 2 (EC 3.4. . ) (Microsomal signal peptidase 25 kDa subunit) (SPase 25 kDa subunit)
  • Length: 226  
  • Mass: 25003
• Sequence:

  MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYV
  ENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTG
  MDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKI
  K

• Structural information:
  • Interpro: IPR009582  
  • DIP: 47276
  • STRING: ENSP00000263672
• Other Databases: GeneCards:  SPCS2  Malacards:  SPCS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005787	signal peptidase complex	IBA	cellular component
GO:0006465	signal peptide processing	IBA	biological process
GO:0045047	protein targeting to ER	IBA	biological process
GO:0005787	signal peptidase complex	IEA	cellular component
GO:0006465	signal peptide processing	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray