• Gene id: 9787

Gene Summary

• Gene Symbol: DLGAP5   Gene   UCSC   Ensembl
• Aliases: DLG7, HURP
• Gene name: DLG associated protein 5
• Alternate names: disks large-associated protein 5, DAP-5, discs large homolog associated protein 5, discs, large homolog 7, disks large-associated protein DLG7, hepatoma up-regulated protein,
• Gene location: 14q22.3 (55191584: 55148129)     Exons: 21     NC_000014.9
• OMIM: 617859

Protein Summary

• Protein general information: Q15398  
  • Name: Disks large associated protein 5 (DAP 5) (Discs large homolog 7) (Disks large associated protein DLG7) (Hepatoma up regulated protein) (HURP)
  • Length: 846  
  • Mass: 95115
  • Tissue specificity: Abundantly expressed in fetal liver. Expressed at lower levels in bone marrow, testis, colon, and placenta. {ECO
• Sequence:

  MSSSHFASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKT
  NVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAEPKKAIPSSV
  RITRSKAKDQMEQTKIDNESDVRAIRPGPRQTSEKKVSDKEKKVVQPVMPTSLRMTRSATQAAKQVPRTVSSTTA
  RKPVTRAANENEPEGKVPSKGRPAKNVETKPDKGISCKVDSEENTLNSQTNATSGMNPDGVLSKMENLPEINTAK
  IKGKNSFAPKDFMFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLKTEVDESQATKEILAQKCKTYSTKTIQQD
  SNKLPCPLGPLTVWHEEHVLNKNEATTKNLNGLPIKEVPSLERNEGRIAQPHHGVPYFRNILQSETEKLTSHCFE
  WDRKLELDIPDDAKDLIRTAVGQTRLLMKERFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFN
  NLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVI
  PKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEH
  VKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVE
  GMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEH
  ARHISFGGNLITFSPLQPGEF

• Structural information:
  • Interpro: IPR005026  
  • STRING: ENSP00000247191
• Other Databases: GeneCards:  DLGAP5  Malacards:  DLGAP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0023052	signaling	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0007221	positive regulation of transcription of Notch receptor target	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031616	spindle pole centrosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045842	positive regulation of mitotic metaphase/anaphase transition	NAS	biological process
GO:0007079	mitotic chromosome movement towards spindle pole	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R