• Gene id: 9784

Gene Summary

• Gene Symbol: SNX17   Gene   UCSC   Ensembl
• Gene name: sorting nexin 17
• Alternate names: sorting nexin-17,
• Gene location: 2p23.3 (27370495: 27377534)     Exons: 16     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like

Protein Summary

• Protein general information: Q15036  
  • Name: Sorting nexin 17
  • Length: 470  
  • Mass: 52901
• Sequence:

  MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQR
  REQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKL
  DLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLY
  AQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
  LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSIC
  LQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTD
  ASASDVHGNFAFEGIGDEDL

• Structural information:
  • Protein Domains: (1..10-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147-)
    (115..20-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166"-)
  • Interpro: IPR011993  IPR001683  IPR036871  IPR000159  IPR028666   IPR037831  IPR040842  IPR037836  
  • Prosite: PS50195 PS50200
  • CDD: cd13337
  • PDB: 3FOG 3LUI 4GXB 4TKN
  • PDBsum: 3FOG 3LUI 4GXB 4TKN
  • DIP: 52265
  • STRING: ENSP00000233575
• Other Databases: GeneCards:  SNX17  Malacards:  SNX17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990126	retrograde transport, endosome to plasma membrane	IBA	biological process
GO:0035091	phosphatidylinositol binding	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:1990126	retrograde transport, endosome to plasma membrane	IMP	biological process
GO:0032456	endocytic recycling	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0060976	coronary vasculature development	IEA	biological process
GO:0003279	cardiac septum development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0035904	aorta development	IEA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0050750	low-density lipoprotein particle receptor binding	IDA	molecular function
GO:0006707	cholesterol catabolic process	IC	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0030100	regulation of endocytosis	NAS	biological process
GO:0016020	membrane	NAS	cellular component
GO:0016197	endosomal transport	NAS	biological process
GO:0006886	intracellular protein transport	NAS	biological process
GO:0005102	signaling receptor binding	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq