• Gene id: 9783

Gene Summary

• Gene Symbol: RIMS3   Gene   UCSC   Ensembl
• Aliases: NIM3, RIM 3, RIM3
• Gene name: regulating synaptic membrane exocytosis 3
• Alternate names: regulating synaptic membrane exocytosis protein 3, RIM3 gamma, Rab-3 interacting molecule 3, rab-3-interacting molecule 3,
• Gene location: 1p34.2 (40692103: 40620679)     Exons: 9     NC_000001.11
• OMIM: 603537

Protein Summary

• Protein general information: Q9UJD0  
  • Name: Regulating synaptic membrane exocytosis protein 3 (Nim3) (RIM3 gamma) (Rab 3 interacting molecule 3) (RIM 3)
  • Length: 308  
  • Mass: 32796
• Sequence:

  MFNGEPGPASSGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMVAIVGLTQWSKSTLQLPQPEGA
  TKKLRSNIRRSTETGIAVEMRSRVTRQGSRESTDGSTNSNSSDGTFIFPTTRLGAESQFSDFLDGLGPAQIVGRQ
  TLATPPMGDVHIAIMDRSGQLEVEVIEARGLTPKPGSKSLPATYIKVYLLENGACLAKKKTKMTKKTCDPLYQQA
  LLFDEGPQGKVLQVIVWGDYGRMDHKCFMGMAQIMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLE
  SATSPSCS

• Structural information:
  • Protein Domains: (156..27-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR039032  
  • Prosite: PS50004
  • STRING: ENSP00000361769
• Other Databases: GeneCards:  RIMS3  Malacards:  RIMS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000300	regulation of synaptic vesicle exocytosis	ISS	biological process
GO:0044325	ion channel binding	ISS	molecular function
GO:0017156	calcium-ion regulated exocytosis	ISS	biological process
GO:0042391	regulation of membrane potential	ISS	biological process
GO:0048786	presynaptic active zone	TAS	cellular component
GO:2000300	regulation of synaptic vesicle exocytosis	IBA	biological process
GO:0098831	presynaptic active zone cytoplasmic component	IBA	cellular component
GO:0050806	positive regulation of synaptic transmission	IBA	biological process
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IBA	biological process
GO:0048788	cytoskeleton of presynaptic active zone	IBA	cellular component
GO:0048167	regulation of synaptic plasticity	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0042734	presynaptic membrane	IBA	cellular component
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0045202	synapse	IBA	cellular component
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044325	ion channel binding	IEA	molecular function
GO:0042391	regulation of membrane potential	IEA	biological process
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq