• Gene id: 9776

Gene Summary

• Gene Symbol: ATG13   Gene   UCSC   Ensembl
• Aliases: KIAA0652, PARATARG8
• Gene name: autophagy related 13
• Alternate names: autophagy-related protein 13, ATG13 autophagy related 13 homolog,
• Gene location: 11p11.2 (46617275: 46676018)     Exons: 26     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy. [provided by RefSeq, Oct 2016]
• OMIM: 608214

Protein Summary

• Protein general information: O75143  
  • Name: Autophagy related protein 13
  • Length: 517  
  • Mass: 56572
• Sequence:

  METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPA
  VGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVI
  LYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSP
  MHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQ
  LMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVG
  AFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFK
  PAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ

• Structural information:
  • Interpro: IPR040182  IPR018731  IPR036570  
  • PDB: 3WAN 3WAO 3WAP 5C50 5XUY 5XV1 5XV3 5XV4 5XV6 6HYN
  • PDBsum: 3WAN 3WAO 3WAP 5C50 5XUY 5XV1 5XV3 5XV4 5XV6 6HYN
  • DIP: 60540
  • STRING: ENSP00000432412
• Other Databases: GeneCards:  ATG13  Malacards:  ATG13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903955	positive regulation of protein targeting to mitochondrion	HMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0034727	piecemeal microautophagy of the nucleus	IBA	biological process
GO:0034497	protein localization to phagophore assembly site	IBA	biological process
GO:0019898	extrinsic component of membrane	IBA	cellular component
GO:0019887	protein kinase regulator activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0000423	mitophagy	IBA	biological process
GO:0000407	phagophore assembly site	IBA	cellular component
GO:1990316	Atg1/ULK1 kinase complex	IBA	cellular component
GO:0044804	autophagy of nucleus	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0016236	macroautophagy	IBA	biological process
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0000045	autophagosome assembly	IBA	biological process
GO:0000407	phagophore assembly site	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990316	Atg1/ULK1 kinase complex	IPI	cellular component
GO:1990316	Atg1/ULK1 kinase complex	IPI	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IMP	biological process
GO:0000045	autophagosome assembly	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:1990316	Atg1/ULK1 kinase complex	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000045	autophagosome assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016236	macroautophagy	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0000423	mitophagy	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0000045	autophagosome assembly	IEA	biological process
GO:0098780	response to mitochondrial depolarisation	IEA	biological process
GO:1990316	Atg1/ULK1 kinase complex	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0000407	phagophore assembly site	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa04211	Longevity regulating pathway
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray